KEGG   Pteropus alecto (black flying fox): 102879163
Entry
102879163         CDS       T02993                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04210  Apoptosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04218  Cellular senescence
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04620  Toll-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04668  TNF signaling pathway
pale04670  Leukocyte transendothelial migration
pale04722  Neurotrophin signaling pathway
pale04725  Cholinergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04926  Relaxin signaling pathway
pale04929  GnRH secretion
pale04930  Type II diabetes mellitus
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale04960  Aldosterone-regulated sodium reabsorption
pale04973  Carbohydrate digestion and absorption
pale05010  Alzheimer disease
pale05017  Spinocerebellar ataxia
pale05020  Prion disease
pale05100  Bacterial invasion of epithelial cells
pale05135  Yersinia infection
pale05142  Chagas disease
pale05146  Amoebiasis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102879163 (PIK3R1)
   04014 Ras signaling pathway
    102879163 (PIK3R1)
   04015 Rap1 signaling pathway
    102879163 (PIK3R1)
   04370 VEGF signaling pathway
    102879163 (PIK3R1)
   04630 JAK-STAT signaling pathway
    102879163 (PIK3R1)
   04668 TNF signaling pathway
    102879163 (PIK3R1)
   04066 HIF-1 signaling pathway
    102879163 (PIK3R1)
   04068 FoxO signaling pathway
    102879163 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    102879163 (PIK3R1)
   04072 Phospholipase D signaling pathway
    102879163 (PIK3R1)
   04071 Sphingolipid signaling pathway
    102879163 (PIK3R1)
   04024 cAMP signaling pathway
    102879163 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    102879163 (PIK3R1)
   04152 AMPK signaling pathway
    102879163 (PIK3R1)
   04150 mTOR signaling pathway
    102879163 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102879163 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    102879163 (PIK3R1)
   04218 Cellular senescence
    102879163 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102879163 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102879163 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102879163 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102879163 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    102879163 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    102879163 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    102879163 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    102879163 (PIK3R1)
   04660 T cell receptor signaling pathway
    102879163 (PIK3R1)
   04662 B cell receptor signaling pathway
    102879163 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    102879163 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    102879163 (PIK3R1)
   04670 Leukocyte transendothelial migration
    102879163 (PIK3R1)
   04062 Chemokine signaling pathway
    102879163 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102879163 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    102879163 (PIK3R1)
   04929 GnRH secretion
    102879163 (PIK3R1)
   04915 Estrogen signaling pathway
    102879163 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    102879163 (PIK3R1)
   04917 Prolactin signaling pathway
    102879163 (PIK3R1)
   04926 Relaxin signaling pathway
    102879163 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    102879163 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    102879163 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102879163 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102879163 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    102879163 (PIK3R1)
   04722 Neurotrophin signaling pathway
    102879163 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102879163 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    102879163 (PIK3R1)
   04380 Osteoclast differentiation
    102879163 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    102879163 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    102879163 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102879163 (PIK3R1)
   05206 MicroRNAs in cancer
    102879163 (PIK3R1)
   05205 Proteoglycans in cancer
    102879163 (PIK3R1)
   05203 Viral carcinogenesis
    102879163 (PIK3R1)
   05230 Central carbon metabolism in cancer
    102879163 (PIK3R1)
   05231 Choline metabolism in cancer
    102879163 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102879163 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102879163 (PIK3R1)
   05212 Pancreatic cancer
    102879163 (PIK3R1)
   05225 Hepatocellular carcinoma
    102879163 (PIK3R1)
   05226 Gastric cancer
    102879163 (PIK3R1)
   05214 Glioma
    102879163 (PIK3R1)
   05221 Acute myeloid leukemia
    102879163 (PIK3R1)
   05220 Chronic myeloid leukemia
    102879163 (PIK3R1)
   05218 Melanoma
    102879163 (PIK3R1)
   05211 Renal cell carcinoma
    102879163 (PIK3R1)
   05215 Prostate cancer
    102879163 (PIK3R1)
   05213 Endometrial cancer
    102879163 (PIK3R1)
   05224 Breast cancer
    102879163 (PIK3R1)
   05222 Small cell lung cancer
    102879163 (PIK3R1)
   05223 Non-small cell lung cancer
    102879163 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102879163 (PIK3R1)
   05017 Spinocerebellar ataxia
    102879163 (PIK3R1)
   05020 Prion disease
    102879163 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102879163 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102879163 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    102879163 (PIK3R1)
   04931 Insulin resistance
    102879163 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102879163 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102879163 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    102879163 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102879163 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    102879163 (PIK3R1)
   05161 Hepatitis B
    102879163 (PIK3R1)
   05160 Hepatitis C
    102879163 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    102879163 (PIK3R1)
   05164 Influenza A
    102879163 (PIK3R1)
   05162 Measles
    102879163 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    102879163 (PIK3R1)
   05163 Human cytomegalovirus infection
    102879163 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102879163 (PIK3R1)
   05169 Epstein-Barr virus infection
    102879163 (PIK3R1)
   05165 Human papillomavirus infection
    102879163 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102879163 (PIK3R1)
   05142 Chagas disease
    102879163 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102879163 (PIK3R1)
   01524 Platinum drug resistance
    102879163 (PIK3R1)
   01522 Endocrine resistance
    102879163 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102879163 (PIK3R1)
Membrane trafficking [BR:pale04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102879163 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_9 DUF4201 SH3_2 Laminin_I Lant_dehydr_C Mod_r PI_PP_I FANCI_S2
Other DBs
NCBI-GeneID: 102879163
NCBI-ProteinID: XP_006913163
LinkDB
Position
Unknown
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEAESEQQALTLPDLAE
QFAPPDAAPPLLIKLVEAIEKKGLECSTLYRTQSSSSPAELRQLLDCDAASVDLETIDVQ
VLADAFKRYLLDLPNPVIPVAVYNEMISLAQEVQSSEDYIQLLKKLIRSPNIPHQYWLTL
QYLLKHFFKLSQTSSKNLLTARVLSELFSPLLFRFPAASSENTEHLIKIIEILISTEWSE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgccgaggggtaccagtatagagcactgtatgattataaaaaggaacgagaagaa
gatattgacttgcacttgggtgacatattgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaattggctggttaaatggctataat
gaaaccacgggggagagaggggactttccaggaacttatgtagaatatattggaaggaaa
aaaatctcgcctccgaccccaaagccccggccacctcgaccgcttcctgttgccccaggt
tcttcaaaaactgaagcagaaagtgagcaacaagctttgacccttccggatctcgcagag
cagtttgcccctcctgacgctgctccacctctgctcatcaagcttgtggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcagcccagcagaa
ttacgacagcttcttgattgtgatgccgcctccgtggacttggaaacaatcgatgttcaa
gttttagcagacgctttcaaacgctatctcctggacttaccaaaccctgtcattccagta
gctgtttacaatgaaatgatttctttagcccaagaagtacaaagctccgaagactatatc
cagctgttgaagaagctcattaggtcacctaacatacctcatcagtattggcttacactt
cagtatttgctaaaacatttcttcaagctctcccaaacctccagcaaaaatcttttgact
gcaagagtcctctccgaacttttcagccctctgcttttcaggttcccagcagccagctcc
gagaatactgaacacctcataaaaattatagaaattttaatctcaacggaatggagtgaa
cgacagcctgcaccagcactgcctcctaaaccaccaaaacccactactgtagccaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctcgagg
gaagaagtaaatgaaaaacttcgagatacagctgatgggacctttttggtacgagacgca
tctactaaaatgcatggtgattatactcttacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctctgacccattaaccttcaactct
gtggttgaattaataaaccactaccggaatgagtctctagctcagtacaatcccaagctg
gatgtgaaattactttatccagtgtccaaataccaacaggatcaagttgttaaagaagat
aatattgaagctgtaggaaaaaagttacatgaatataacactcaatttcaagaaaaaagt
cgggaatatgatagattatatgaggattatacccgtacttcccaggaaatccagatgaaa
agaacggctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaaacc
caggagcggtacagcaaagagtacatagaaaagtttaaacgtgaaggcaacgagaaagaa
atacaaaggattatgcataattatgaaaagttaaagtctcgaatcagtgaaattgttgac
agtaggagaagactggaggaagacttgaaaaagcaggcagctgagtatcgggagattgac
aaacgcatgaacagcatcaaaccggacctcattcagctgagaaagacacgagaccaatac
ttgatgtggttgactcagaaaggagttcggcagaagaagttgaacgagtggctgggcaat
gaaaacactgaagaccaatattcactggtggaagacgatgaggatttgccccaccatgat
gagaagacatggaacgtcggaagcagcaaccgaaacaaagctgaaaacctactgcgaggg
aagcgagatggcacatttcttgtccgggaaagcagtaagcaaggctgctacgcctgctct
gtggtggtggacggcgaggtaaagcactgtgtcataaacaaaacggcgaccggctacggc
tttgccgagccctataacctgtacagctctctgaaggaactggtgctacattaccaacac
acctccctcgtgcagcacaacgactccctcaacgtcacactagcctacccggtgtacgca
cagcagaggcgatga

KEGG   Pteropus alecto (black flying fox): 102879453
Entry
102879453         CDS       T02993                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04210  Apoptosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04218  Cellular senescence
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04620  Toll-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04668  TNF signaling pathway
pale04670  Leukocyte transendothelial migration
pale04722  Neurotrophin signaling pathway
pale04725  Cholinergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04926  Relaxin signaling pathway
pale04929  GnRH secretion
pale04930  Type II diabetes mellitus
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale04960  Aldosterone-regulated sodium reabsorption
pale04973  Carbohydrate digestion and absorption
pale05010  Alzheimer disease
pale05017  Spinocerebellar ataxia
pale05020  Prion disease
pale05100  Bacterial invasion of epithelial cells
pale05135  Yersinia infection
pale05142  Chagas disease
pale05146  Amoebiasis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102879453 (PIK3R2)
   04014 Ras signaling pathway
    102879453 (PIK3R2)
   04015 Rap1 signaling pathway
    102879453 (PIK3R2)
   04370 VEGF signaling pathway
    102879453 (PIK3R2)
   04630 JAK-STAT signaling pathway
    102879453 (PIK3R2)
   04668 TNF signaling pathway
    102879453 (PIK3R2)
   04066 HIF-1 signaling pathway
    102879453 (PIK3R2)
   04068 FoxO signaling pathway
    102879453 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    102879453 (PIK3R2)
   04072 Phospholipase D signaling pathway
    102879453 (PIK3R2)
   04071 Sphingolipid signaling pathway
    102879453 (PIK3R2)
   04024 cAMP signaling pathway
    102879453 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    102879453 (PIK3R2)
   04152 AMPK signaling pathway
    102879453 (PIK3R2)
   04150 mTOR signaling pathway
    102879453 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102879453 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    102879453 (PIK3R2)
   04218 Cellular senescence
    102879453 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102879453 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102879453 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102879453 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102879453 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    102879453 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    102879453 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    102879453 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    102879453 (PIK3R2)
   04660 T cell receptor signaling pathway
    102879453 (PIK3R2)
   04662 B cell receptor signaling pathway
    102879453 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    102879453 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    102879453 (PIK3R2)
   04670 Leukocyte transendothelial migration
    102879453 (PIK3R2)
   04062 Chemokine signaling pathway
    102879453 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102879453 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    102879453 (PIK3R2)
   04929 GnRH secretion
    102879453 (PIK3R2)
   04915 Estrogen signaling pathway
    102879453 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    102879453 (PIK3R2)
   04917 Prolactin signaling pathway
    102879453 (PIK3R2)
   04926 Relaxin signaling pathway
    102879453 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    102879453 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    102879453 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102879453 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102879453 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    102879453 (PIK3R2)
   04722 Neurotrophin signaling pathway
    102879453 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102879453 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    102879453 (PIK3R2)
   04380 Osteoclast differentiation
    102879453 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    102879453 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    102879453 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102879453 (PIK3R2)
   05206 MicroRNAs in cancer
    102879453 (PIK3R2)
   05205 Proteoglycans in cancer
    102879453 (PIK3R2)
   05203 Viral carcinogenesis
    102879453 (PIK3R2)
   05230 Central carbon metabolism in cancer
    102879453 (PIK3R2)
   05231 Choline metabolism in cancer
    102879453 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102879453 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102879453 (PIK3R2)
   05212 Pancreatic cancer
    102879453 (PIK3R2)
   05225 Hepatocellular carcinoma
    102879453 (PIK3R2)
   05226 Gastric cancer
    102879453 (PIK3R2)
   05214 Glioma
    102879453 (PIK3R2)
   05221 Acute myeloid leukemia
    102879453 (PIK3R2)
   05220 Chronic myeloid leukemia
    102879453 (PIK3R2)
   05218 Melanoma
    102879453 (PIK3R2)
   05211 Renal cell carcinoma
    102879453 (PIK3R2)
   05215 Prostate cancer
    102879453 (PIK3R2)
   05213 Endometrial cancer
    102879453 (PIK3R2)
   05224 Breast cancer
    102879453 (PIK3R2)
   05222 Small cell lung cancer
    102879453 (PIK3R2)
   05223 Non-small cell lung cancer
    102879453 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102879453 (PIK3R2)
   05017 Spinocerebellar ataxia
    102879453 (PIK3R2)
   05020 Prion disease
    102879453 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102879453 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102879453 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    102879453 (PIK3R2)
   04931 Insulin resistance
    102879453 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102879453 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102879453 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    102879453 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102879453 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    102879453 (PIK3R2)
   05161 Hepatitis B
    102879453 (PIK3R2)
   05160 Hepatitis C
    102879453 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    102879453 (PIK3R2)
   05164 Influenza A
    102879453 (PIK3R2)
   05162 Measles
    102879453 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    102879453 (PIK3R2)
   05163 Human cytomegalovirus infection
    102879453 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102879453 (PIK3R2)
   05169 Epstein-Barr virus infection
    102879453 (PIK3R2)
   05165 Human papillomavirus infection
    102879453 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102879453 (PIK3R2)
   05142 Chagas disease
    102879453 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102879453 (PIK3R2)
   01524 Platinum drug resistance
    102879453 (PIK3R2)
   01522 Endocrine resistance
    102879453 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102879453 (PIK3R2)
Membrane trafficking [BR:pale04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102879453 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 ATG11 Ribosomal_L22e Tai4
Other DBs
NCBI-GeneID: 102879453
NCBI-ProteinID: XP_006904360
LinkDB
Position
Unknown
AA seq 728 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDLLVVSRAALQVLGVAEGSERCPQNVGWMPGL
NERTRQRGDFPGTYVEFLGPVALSRPGPRPRGPRPLPARPQEGAPEPGPTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESLYRPELPPLRTDWSLSDVDQWDAATLADGIKGFLLA
LPSPIMTPEAAAEARRALREAVGPIGPVLEPPTLPLHHALTLRFLLQHLGRMARRAPAPG
PAVRALGTAFGPLLQLRAAPPSPPPPGGAPDGTELFPDFPALLVEKLLQEHLEEQEVAPP
ALPPKPPKAKPTPIGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSK
IQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLIAHYRHESLAQYNAKLDTR
LLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTA
IEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRXXLNSERLKSRIAEIHESRT
KLEQELRAQALDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGTRQKKINEWLGIKNE
TEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLNGKRDGTFLIRESSQRGCYACSVV
VDGDTKHCVIYRTATGLGFAEPYNLYGSLKELVLHYQHTSLVQHNDALTVTLAHPVRAPG
PGPPPTTR
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggctggcgctgagggcttccagtaccgtgcactgtacccatttcgtcgggagcggcca
gaggacctggagctgctaccaggcgacttgctggtggtgagccgggcggccctgcaggtc
ctgggtgtggccgagggcagtgagcgctgcccacagaacgtgggctggatgcctggcctc
aacgaacgcacacggcagcgcggtgattttccaggcacctatgtcgagttcctggggcct
gtggccctgtccaggcctggccctcgcccccgtggcccccgcccactgcctgccaggccc
caagagggggcccccgagccaggccccacactccctgacctgcctgagcagttctcccca
cctgatgtggctccccctctcctggtgaagcttgtggaggccattgagcggacagggcta
gacagcgaatccctctacaggcctgagctgcctcccctgcgcacagactggtccttgagc
gacgtggatcagtgggatgcggcaactctggcggatggcatcaagggcttcttgctggcg
ctgccctcgcccatcatgacaccggaggccgcggccgaggctcgccgggccctgcgggag
gccgtgggacccatagggccggtgctggagcccccgacgctgccactgcaccatgcgctc
acgctgcgcttcctgctccagcaccttggtcgcatggcccggcgtgcccctgcccctggc
ccagcggtgcgagccctgggcactgccttcgggccgctcctgcagctgcgcgctgctccg
ccttcgccgccgccgccagggggcgcacccgatgggactgagctcttccccgacttcccg
gccttgctggtggaaaagttgcttcaggagcacctggaggagcaggaggttgcaccacca
gcactgccacctaaaccacccaaagcaaagcccacccccatagggctggccaatgggggg
agcccaccctccctgcaggatgctgagtggtactggggtgacatctccagggaagaggtg
aacgaaaaactccgggacacacctgatggtaccttcctggtccgagatgcctccagcaag
atccagggagagtacactctgaccctcaggaaaggcgggaacaacaagctgattaaggtc
ttccaccgcgacgggcactacggcttctcggaaccactcaccttctgctctgttgtggac
ctcattgcccactaccgccatgagtccctggcccagtacaacgccaaactggacacgcgg
ctcctctaccctgtatccaagtaccagcaggaccagattgtcaaggaggacagtgtggag
gcagtgggtgcccagctcaaagtctaccaccagcagtaccaggacaagagccgcgagtac
gaccagctctacgaggagtacacacgtacctcccaggaactacagatgaagcgcaccgca
attgaggccttcaatgaaaccatcaagatctttgaagagcagggccagacgcaagagaag
tgtagcaaggaatatctggaacgcttccggcgtgagggcaatgagaaagagatgcagagg
nnnnnnctgaactcggagcgactcaagtctcgcattgctgaaatccatgagagccgcacg
aagctggaacaggagctgcgggcacaggccttggacaaccgggagatcgacaagcgcatg
aacagcctaaagccagacctcatgcagctgcgcaagatccgagaccagtacctggtatgg
ctcacccagaaaggcacccggcagaagaaaatcaacgaatggttggggatcaaaaatgag
actgaggaccagtacgccctgatggaggacgaggatgacctgccccaccacgaggaacgc
acctggtacgtgggcaagatcaaccgcacacaggctgaggaaatgctgaacggcaaacga
gatggcaccttcctcatccgtgagagcagccagcgaggctgctacgcctgctctgtggtg
gtggatggcgacaccaagcactgcgttatctaccgcacggccaccggcttgggctttgca
gagccctacaatctgtatgggtccttaaaggagctggtgctgcattaccaacacacctcc
ttggtgcagcacaacgacgcgctcactgtcacattggcccaccctgttcgagcccctggc
cccgggcccccacccaccacccgctga

KEGG   Pteropus alecto (black flying fox): 102880320
Entry
102880320         CDS       T02993                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00562  Inositol phosphate metabolism
pale01100  Metabolic pathways
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04210  Apoptosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04218  Cellular senescence
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04620  Toll-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04668  TNF signaling pathway
pale04670  Leukocyte transendothelial migration
pale04722  Neurotrophin signaling pathway
pale04725  Cholinergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04926  Relaxin signaling pathway
pale04929  GnRH secretion
pale04930  Type II diabetes mellitus
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale04960  Aldosterone-regulated sodium reabsorption
pale04973  Carbohydrate digestion and absorption
pale05010  Alzheimer disease
pale05017  Spinocerebellar ataxia
pale05020  Prion disease
pale05100  Bacterial invasion of epithelial cells
pale05132  Salmonella infection
pale05135  Yersinia infection
pale05142  Chagas disease
pale05146  Amoebiasis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102880320 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102880320 (PIK3CB)
   04014 Ras signaling pathway
    102880320 (PIK3CB)
   04015 Rap1 signaling pathway
    102880320 (PIK3CB)
   04370 VEGF signaling pathway
    102880320 (PIK3CB)
   04630 JAK-STAT signaling pathway
    102880320 (PIK3CB)
   04668 TNF signaling pathway
    102880320 (PIK3CB)
   04066 HIF-1 signaling pathway
    102880320 (PIK3CB)
   04068 FoxO signaling pathway
    102880320 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102880320 (PIK3CB)
   04072 Phospholipase D signaling pathway
    102880320 (PIK3CB)
   04071 Sphingolipid signaling pathway
    102880320 (PIK3CB)
   04024 cAMP signaling pathway
    102880320 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    102880320 (PIK3CB)
   04152 AMPK signaling pathway
    102880320 (PIK3CB)
   04150 mTOR signaling pathway
    102880320 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102880320 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    102880320 (PIK3CB)
   04218 Cellular senescence
    102880320 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102880320 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    102880320 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102880320 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102880320 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    102880320 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    102880320 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    102880320 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    102880320 (PIK3CB)
   04660 T cell receptor signaling pathway
    102880320 (PIK3CB)
   04662 B cell receptor signaling pathway
    102880320 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    102880320 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    102880320 (PIK3CB)
   04670 Leukocyte transendothelial migration
    102880320 (PIK3CB)
   04062 Chemokine signaling pathway
    102880320 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102880320 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    102880320 (PIK3CB)
   04929 GnRH secretion
    102880320 (PIK3CB)
   04915 Estrogen signaling pathway
    102880320 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102880320 (PIK3CB)
   04917 Prolactin signaling pathway
    102880320 (PIK3CB)
   04926 Relaxin signaling pathway
    102880320 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    102880320 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    102880320 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102880320 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102880320 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    102880320 (PIK3CB)
   04722 Neurotrophin signaling pathway
    102880320 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102880320 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    102880320 (PIK3CB)
   04380 Osteoclast differentiation
    102880320 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    102880320 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    102880320 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102880320 (PIK3CB)
   05206 MicroRNAs in cancer
    102880320 (PIK3CB)
   05205 Proteoglycans in cancer
    102880320 (PIK3CB)
   05203 Viral carcinogenesis
    102880320 (PIK3CB)
   05230 Central carbon metabolism in cancer
    102880320 (PIK3CB)
   05231 Choline metabolism in cancer
    102880320 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102880320 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102880320 (PIK3CB)
   05212 Pancreatic cancer
    102880320 (PIK3CB)
   05225 Hepatocellular carcinoma
    102880320 (PIK3CB)
   05226 Gastric cancer
    102880320 (PIK3CB)
   05214 Glioma
    102880320 (PIK3CB)
   05221 Acute myeloid leukemia
    102880320 (PIK3CB)
   05220 Chronic myeloid leukemia
    102880320 (PIK3CB)
   05218 Melanoma
    102880320 (PIK3CB)
   05211 Renal cell carcinoma
    102880320 (PIK3CB)
   05215 Prostate cancer
    102880320 (PIK3CB)
   05213 Endometrial cancer
    102880320 (PIK3CB)
   05224 Breast cancer
    102880320 (PIK3CB)
   05222 Small cell lung cancer
    102880320 (PIK3CB)
   05223 Non-small cell lung cancer
    102880320 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102880320 (PIK3CB)
   05017 Spinocerebellar ataxia
    102880320 (PIK3CB)
   05020 Prion disease
    102880320 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102880320 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102880320 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    102880320 (PIK3CB)
   04931 Insulin resistance
    102880320 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102880320 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102880320 (PIK3CB)
   05135 Yersinia infection
    102880320 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    102880320 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102880320 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    102880320 (PIK3CB)
   05161 Hepatitis B
    102880320 (PIK3CB)
   05160 Hepatitis C
    102880320 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    102880320 (PIK3CB)
   05164 Influenza A
    102880320 (PIK3CB)
   05162 Measles
    102880320 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    102880320 (PIK3CB)
   05163 Human cytomegalovirus infection
    102880320 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102880320 (PIK3CB)
   05169 Epstein-Barr virus infection
    102880320 (PIK3CB)
   05165 Human papillomavirus infection
    102880320 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102880320 (PIK3CB)
   05142 Chagas disease
    102880320 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102880320 (PIK3CB)
   01524 Platinum drug resistance
    102880320 (PIK3CB)
   01522 Endocrine resistance
    102880320 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102880320 (PIK3CB)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102880320 (PIK3CB)
Membrane trafficking [BR:pale04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102880320 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4135
Other DBs
NCBI-GeneID: 102880320
NCBI-ProteinID: XP_024899357
LinkDB
Position
Unknown
AA seq 1081 aa
MCFSFIMPPAMADILDIWAVDSQITSDGSILVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRIKMRKLSEEKIQSLVGLSWMDWLKQTYPPEH
EPSILENLEDKLYGGKLIVAIHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDE
VSPCDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIILVKGSKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCLAVYAVLDKVKTKKSTKTM
NASKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIVLHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALYIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLVELKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVECLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVCIQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNXXXXXXXXXXXXXXXXXXXXXEAMHTCLKQNAYREALSDLQSPLNPCVILS
ELYVEKCKYMDSKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKE
AGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYN
SGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKNGQLFHIDFGHILGNFKSKF
GIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLT
AGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYR
S
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgtgcttcagtttcataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagataacatctgatggctccatactcgtggatttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcttatattaaacagatgttgtgg
aagcaggttcacaattacccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggaacttgaagatgaaacaagaaggctgtgt
gatgtcagaccttttcttccagttctcaagttagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctacatgaatttgatgccttg
aaggatcctgaagtcaatgaattccgaataaaaatgcgcaagttgagtgaggaaaagatt
cagtcgcttgtgggattgtcttggatggactggctaaagcaaacatatccaccagagcat
gaaccatccattcttgaaaacttagaagataagctttatggaggaaagctcattgtggct
attcattttgaaaattgtcaggatgtgtttagttttcaagtatctcctaatatgaatcct
atcaaggtaaatgaattggcaatccaaaaacgtttgactattcatgggaaagaagatgaa
gttagcccctgtgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgat
cacccactaattcagttccagtatatccgaaactgtgtaatgaacaggaccttgccgcat
tttatacttgtggaatgttgcaagatcaaaaagatgtacgaacaggaaatgattgccata
gaggctgccataaatcgaaattcatctaaccttcctcttcctttaccaccaaagaaaact
cgaattatttctcatgtttgggaaaataacaaccctttccaaattatcttggttaaggga
agtaaacttaacacagaagaaactgtaaaagttcatgtcagggctggcctttttcatggt
actgaactcttgtgtaaaacgattgtaagctcagagatatcagggaaaaacgatcacatt
tggaatgaaccactggaatttgatattaatacttgtgacctgccacgaatggctagatta
tgtttggctgtttatgcagttttggataaagtgaaaacaaaaaaatcaactaaaacaatg
aatgcctctaaatatcagaccatcaggaaatctgggaaagtgcattatcctgtagcgtgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagacatagtattgcac
agttggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatacagaaaatgcaacagctttgtatatcaaattcccagagaataaaaaa
caaccttattattaccctcccttcgataagataatcgaaaaggcagctgagatcgcaagc
agtgatagtgctaatgtatcaagtcggggtggaaaaaagtttcttgttgaactgaaggaa
atcttggacagggatcccttgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgccgagagaattttccacagtcactgccaaaattattactgtcgata
aagtggaataaacttgaagatgttgctcagcttcaggcactgctacagatttggcctaaa
ctgcccccccgggaggctctggagcttctagatttcaactatccagatcagtatgtgcgg
gaatatgctgtggaatgcctgcaacaaatgagtgatgaagaactctctcagtatctttta
cagctggtgcaagttttaaaatatgagccttttcttgattgcgccctctctagattttta
ttagaaagagcacttgctaatcggaggataggacaatttctcttttggcaccttagatca
gaagtgcacatccctgctgtctgcatacaatttggtgtcattctcgaagcgtactgccgg
ggaagcgtcgggcacatgaaagtgctttccaagcaggttgaagcactcaataagttaaaa
actttaaatagtttaatcaaactgaatnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnngaggccatgcacacttgtttaaaacagaat
gcttaccgggaagccctctctgacctgcagtcacctctgaacccatgtgtcatcctctca
gaactctatgttgaaaagtgtaaatacatggattctaaaatgaagcctttgtggctggtg
tacaacaacaaggtgtttggtgaggattcagtcggagtgatttttaaaaatggtgatgat
ttacgacaggatatgttgacactccaaatgctgcgcttgatggatttactgtggaaagaa
gctggtcttgatcttcgaatgttgccttatggctgtttagcaacaggagatcgctctggc
ctcattgaagttgtgagcacctctgaaacaattgctgacattcagctgaacagtagcaac
gtggctgctacagcagccttcaataaagatgcccttctgaactggcttaaagaatacaat
tctggggatgacctggaccgagccattgaagagtttaccctgtcctgtgctggctactgt
gtagcttcttatgtccttgggattggtgacagacatagtgacaacatcatggtaaaaaaa
aatggccagctcttccacattgactttggacatattcttggaaatttcaagtctaaattt
ggcattaaaagggaacgagtgccttttattcttacttatgatttcattcatgtgattcaa
caaggaaaaacaggaaacacagaaaaatttggccggttccgccagtgttgtgaggatgca
tatctgattttacgacggcatgggaatctcttcatcactctcttcgcactgatgttgact
gcagggcttcctgagctcacatcagtcaaggatatacagtatcttaaggattctcttgcc
ttagggaagagcgaagaagaagcactcaagcaatttaagcaaaaatttgatgaggcactc
agggaaagctggactactaaagtgaactggatggcccacacagttcggaaagactacaga
tcttaa

KEGG   Pteropus alecto (black flying fox): 102889227
Entry
102889227         CDS       T02993                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00562  Inositol phosphate metabolism
pale01100  Metabolic pathways
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04210  Apoptosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04218  Cellular senescence
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04620  Toll-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04668  TNF signaling pathway
pale04670  Leukocyte transendothelial migration
pale04722  Neurotrophin signaling pathway
pale04725  Cholinergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04926  Relaxin signaling pathway
pale04929  GnRH secretion
pale04930  Type II diabetes mellitus
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale04960  Aldosterone-regulated sodium reabsorption
pale04973  Carbohydrate digestion and absorption
pale05010  Alzheimer disease
pale05017  Spinocerebellar ataxia
pale05020  Prion disease
pale05100  Bacterial invasion of epithelial cells
pale05132  Salmonella infection
pale05135  Yersinia infection
pale05142  Chagas disease
pale05146  Amoebiasis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102889227 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102889227 (PIK3CA)
   04014 Ras signaling pathway
    102889227 (PIK3CA)
   04015 Rap1 signaling pathway
    102889227 (PIK3CA)
   04370 VEGF signaling pathway
    102889227 (PIK3CA)
   04630 JAK-STAT signaling pathway
    102889227 (PIK3CA)
   04668 TNF signaling pathway
    102889227 (PIK3CA)
   04066 HIF-1 signaling pathway
    102889227 (PIK3CA)
   04068 FoxO signaling pathway
    102889227 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    102889227 (PIK3CA)
   04072 Phospholipase D signaling pathway
    102889227 (PIK3CA)
   04071 Sphingolipid signaling pathway
    102889227 (PIK3CA)
   04024 cAMP signaling pathway
    102889227 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    102889227 (PIK3CA)
   04152 AMPK signaling pathway
    102889227 (PIK3CA)
   04150 mTOR signaling pathway
    102889227 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102889227 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    102889227 (PIK3CA)
   04218 Cellular senescence
    102889227 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102889227 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    102889227 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102889227 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102889227 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    102889227 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    102889227 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    102889227 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    102889227 (PIK3CA)
   04660 T cell receptor signaling pathway
    102889227 (PIK3CA)
   04662 B cell receptor signaling pathway
    102889227 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    102889227 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    102889227 (PIK3CA)
   04670 Leukocyte transendothelial migration
    102889227 (PIK3CA)
   04062 Chemokine signaling pathway
    102889227 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102889227 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    102889227 (PIK3CA)
   04929 GnRH secretion
    102889227 (PIK3CA)
   04915 Estrogen signaling pathway
    102889227 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    102889227 (PIK3CA)
   04917 Prolactin signaling pathway
    102889227 (PIK3CA)
   04926 Relaxin signaling pathway
    102889227 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    102889227 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    102889227 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102889227 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102889227 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    102889227 (PIK3CA)
   04722 Neurotrophin signaling pathway
    102889227 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102889227 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    102889227 (PIK3CA)
   04380 Osteoclast differentiation
    102889227 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    102889227 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    102889227 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102889227 (PIK3CA)
   05206 MicroRNAs in cancer
    102889227 (PIK3CA)
   05205 Proteoglycans in cancer
    102889227 (PIK3CA)
   05203 Viral carcinogenesis
    102889227 (PIK3CA)
   05230 Central carbon metabolism in cancer
    102889227 (PIK3CA)
   05231 Choline metabolism in cancer
    102889227 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102889227 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102889227 (PIK3CA)
   05212 Pancreatic cancer
    102889227 (PIK3CA)
   05225 Hepatocellular carcinoma
    102889227 (PIK3CA)
   05226 Gastric cancer
    102889227 (PIK3CA)
   05214 Glioma
    102889227 (PIK3CA)
   05221 Acute myeloid leukemia
    102889227 (PIK3CA)
   05220 Chronic myeloid leukemia
    102889227 (PIK3CA)
   05218 Melanoma
    102889227 (PIK3CA)
   05211 Renal cell carcinoma
    102889227 (PIK3CA)
   05215 Prostate cancer
    102889227 (PIK3CA)
   05213 Endometrial cancer
    102889227 (PIK3CA)
   05224 Breast cancer
    102889227 (PIK3CA)
   05222 Small cell lung cancer
    102889227 (PIK3CA)
   05223 Non-small cell lung cancer
    102889227 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102889227 (PIK3CA)
   05017 Spinocerebellar ataxia
    102889227 (PIK3CA)
   05020 Prion disease
    102889227 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102889227 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102889227 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    102889227 (PIK3CA)
   04931 Insulin resistance
    102889227 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102889227 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102889227 (PIK3CA)
   05135 Yersinia infection
    102889227 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    102889227 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102889227 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    102889227 (PIK3CA)
   05161 Hepatitis B
    102889227 (PIK3CA)
   05160 Hepatitis C
    102889227 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    102889227 (PIK3CA)
   05164 Influenza A
    102889227 (PIK3CA)
   05162 Measles
    102889227 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    102889227 (PIK3CA)
   05163 Human cytomegalovirus infection
    102889227 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102889227 (PIK3CA)
   05169 Epstein-Barr virus infection
    102889227 (PIK3CA)
   05165 Human papillomavirus infection
    102889227 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102889227 (PIK3CA)
   05142 Chagas disease
    102889227 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102889227 (PIK3CA)
   01524 Platinum drug resistance
    102889227 (PIK3CA)
   01522 Endocrine resistance
    102889227 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102889227 (PIK3CA)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102889227 (PIK3CA)
Membrane trafficking [BR:pale04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102889227 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 102889227
NCBI-ProteinID: XP_006910914
UniProt: L5KPB2
LinkDB
Position
Unknown
AA seq 1069 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWL
KFSSVKFPDMSVIEEHANWSVSREAGFSYAHAGLSNRLARDNELRENDKEQLRAICTRDP
LSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAM
ELLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALT
NQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDIL
KQEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPL
WLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCL
SIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTR
SCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQD
FLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDI
AYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3210 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaataactataaagcatgaactttttaaagaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctctttcaaccctttttaaaa
gtaattgagccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggctttgct
attggcatgccagtatgtgaattcgatatggttaaagatccagaagttcaggacttccga
aggaatattctgaatgtttgtaaagaagctgtggatcttagggatcttaactcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcacctgaactgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaatcatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgttatcatctgaacaactaaaa
ctttgtgttttagaatatcagggcaaatatattttaaaagtatgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtacataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctttactctcaactgccaatggac
tgttttacaatgccgtcttattccagacgtatctccacagctacaccgtatatgaatgga
gaaacatctacaaaatccctttgggttataaatagcgcactcagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatctacgttagaacaggtatc
taccatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgagtggctgaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacattgc
ccattggcctggggaaatataaatttgtttgattacacagatactctagtatctggaaaa
atggctctgaatctttggccagtacctcatggattagaagatttactgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggtta
aaattcagcagtgtaaagtttccagatatgtcagtgattgaagagcatgccaattggtct
gtgtcccgagaagcaggatttagttatgcccacgcaggactgagtaacagactagccaga
gacaacgaattaagggaaaatgataaagaacagctccgagcaatttgtacccgagatcct
ctatctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgta
actatccctgaaattctacctaaattgcttctctccgttaaatggaattctagagatgaa
gtagctcagatgtactgcttggtaaaagattggcctccaatcaaacctgaacaggctatg
gagcttctagactgcaactacccagatcctatggttcgaggctttgctgttcgatgcttg
gaaaaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtccta
aaatatgaacagtatttggataacttgcttgtgagatttttactcaagaaagcattgact
aatcaaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaaca
gttagtcagagatttggcctacttttggagtcctattgtcgtgcatgtggaatgtatttg
aagcacctgaataggcaagttgaggctatggaaaagctcattaacttaactgacattctc
aaacaagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatg
cggcgaccagatttcatggatgctctgcagggctttctatctcctctaaaccctgctcat
caactaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactg
tggttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatc
atcttcaaaaatggggatgatttacggcaagatatgctaacacttcaaattatccgcatt
atggaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccatatggatgtctg
tcaattggtgactgtgtgggacttattgaggtggtgagaaattctcacactattatgcaa
attcagtgcaaaggcggcctgaaaggtgcactgcagttcaacagccacacactacatcag
tggctcaaagacaagaacaaaggagaaatatacgatgcagccattgatctgtttacacgt
tcatgcgctggatattgtgttgctaccttcattttgggaattggagatcgtcacaatagt
aacatcatggttaaagatgatggacaactgtttcatatagattttggacactttttggat
cacaagaagaaaaaatttggctataaacgagagcgcgtgccatttgttttgactcaagat
ttcttgatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgaaagg
tttcaggaaatgtgttacaaagcttatctagctattcggcagcatgccaatctcttcata
aatcttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatatt
gcatacattcgaaagaccctagctttagataaaactgaacaagaagctttggaatatttc
atgaaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttc
cacacaattaagcagcatgctttgaactga

KEGG   Pteropus alecto (black flying fox): 102889576
Entry
102889576         CDS       T02993                                 

Gene name
PIK3CD
Definition
(RefSeq) LOW QUALITY PROTEIN: phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00562  Inositol phosphate metabolism
pale01100  Metabolic pathways
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04210  Apoptosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04218  Cellular senescence
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04620  Toll-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04668  TNF signaling pathway
pale04670  Leukocyte transendothelial migration
pale04722  Neurotrophin signaling pathway
pale04725  Cholinergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04926  Relaxin signaling pathway
pale04929  GnRH secretion
pale04930  Type II diabetes mellitus
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale04960  Aldosterone-regulated sodium reabsorption
pale04973  Carbohydrate digestion and absorption
pale05010  Alzheimer disease
pale05017  Spinocerebellar ataxia
pale05020  Prion disease
pale05100  Bacterial invasion of epithelial cells
pale05132  Salmonella infection
pale05135  Yersinia infection
pale05142  Chagas disease
pale05146  Amoebiasis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102889576 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102889576 (PIK3CD)
   04014 Ras signaling pathway
    102889576 (PIK3CD)
   04015 Rap1 signaling pathway
    102889576 (PIK3CD)
   04370 VEGF signaling pathway
    102889576 (PIK3CD)
   04630 JAK-STAT signaling pathway
    102889576 (PIK3CD)
   04668 TNF signaling pathway
    102889576 (PIK3CD)
   04066 HIF-1 signaling pathway
    102889576 (PIK3CD)
   04068 FoxO signaling pathway
    102889576 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    102889576 (PIK3CD)
   04072 Phospholipase D signaling pathway
    102889576 (PIK3CD)
   04071 Sphingolipid signaling pathway
    102889576 (PIK3CD)
   04024 cAMP signaling pathway
    102889576 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    102889576 (PIK3CD)
   04152 AMPK signaling pathway
    102889576 (PIK3CD)
   04150 mTOR signaling pathway
    102889576 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102889576 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    102889576 (PIK3CD)
   04218 Cellular senescence
    102889576 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102889576 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    102889576 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102889576 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102889576 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    102889576 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    102889576 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    102889576 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    102889576 (PIK3CD)
   04660 T cell receptor signaling pathway
    102889576 (PIK3CD)
   04662 B cell receptor signaling pathway
    102889576 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    102889576 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    102889576 (PIK3CD)
   04670 Leukocyte transendothelial migration
    102889576 (PIK3CD)
   04062 Chemokine signaling pathway
    102889576 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102889576 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    102889576 (PIK3CD)
   04929 GnRH secretion
    102889576 (PIK3CD)
   04915 Estrogen signaling pathway
    102889576 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    102889576 (PIK3CD)
   04917 Prolactin signaling pathway
    102889576 (PIK3CD)
   04926 Relaxin signaling pathway
    102889576 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    102889576 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    102889576 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102889576 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102889576 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    102889576 (PIK3CD)
   04722 Neurotrophin signaling pathway
    102889576 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102889576 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    102889576 (PIK3CD)
   04380 Osteoclast differentiation
    102889576 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    102889576 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    102889576 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102889576 (PIK3CD)
   05206 MicroRNAs in cancer
    102889576 (PIK3CD)
   05205 Proteoglycans in cancer
    102889576 (PIK3CD)
   05203 Viral carcinogenesis
    102889576 (PIK3CD)
   05230 Central carbon metabolism in cancer
    102889576 (PIK3CD)
   05231 Choline metabolism in cancer
    102889576 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102889576 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102889576 (PIK3CD)
   05212 Pancreatic cancer
    102889576 (PIK3CD)
   05225 Hepatocellular carcinoma
    102889576 (PIK3CD)
   05226 Gastric cancer
    102889576 (PIK3CD)
   05214 Glioma
    102889576 (PIK3CD)
   05221 Acute myeloid leukemia
    102889576 (PIK3CD)
   05220 Chronic myeloid leukemia
    102889576 (PIK3CD)
   05218 Melanoma
    102889576 (PIK3CD)
   05211 Renal cell carcinoma
    102889576 (PIK3CD)
   05215 Prostate cancer
    102889576 (PIK3CD)
   05213 Endometrial cancer
    102889576 (PIK3CD)
   05224 Breast cancer
    102889576 (PIK3CD)
   05222 Small cell lung cancer
    102889576 (PIK3CD)
   05223 Non-small cell lung cancer
    102889576 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102889576 (PIK3CD)
   05017 Spinocerebellar ataxia
    102889576 (PIK3CD)
   05020 Prion disease
    102889576 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102889576 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102889576 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    102889576 (PIK3CD)
   04931 Insulin resistance
    102889576 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102889576 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102889576 (PIK3CD)
   05135 Yersinia infection
    102889576 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    102889576 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102889576 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    102889576 (PIK3CD)
   05161 Hepatitis B
    102889576 (PIK3CD)
   05160 Hepatitis C
    102889576 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    102889576 (PIK3CD)
   05164 Influenza A
    102889576 (PIK3CD)
   05162 Measles
    102889576 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    102889576 (PIK3CD)
   05163 Human cytomegalovirus infection
    102889576 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102889576 (PIK3CD)
   05169 Epstein-Barr virus infection
    102889576 (PIK3CD)
   05165 Human papillomavirus infection
    102889576 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102889576 (PIK3CD)
   05142 Chagas disease
    102889576 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102889576 (PIK3CD)
   01524 Platinum drug resistance
    102889576 (PIK3CD)
   01522 Endocrine resistance
    102889576 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102889576 (PIK3CD)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102889576 (PIK3CD)
Membrane trafficking [BR:pale04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102889576 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 102889576
NCBI-ProteinID: XP_015446821
LinkDB
Position
Unknown
AA seq 1045 aa
MPPGVDCPMEFWTKEENQNVTVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQFEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLRDPEVNDFRAKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARTWGP
GTLRVPNRALLVNVKFEGSEESFTFQVSSKDVPLSLMACALRKKATVFRQSLVEHAEDYA
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHCSSILAMRDEQSDPAPQVQKPR
TKPPPIPMKKPSSVSLWSLEQPFCIQLIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVNVCSEPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLTLFDYKDQLKTGECCLYMWPSVPDEKGELLNXXXXXXXTVRSNPNTESAAALVICLP
EVAPHPVYYPALDKILELGRHGEHGRFTEEEQLQLREILERRASGELYEHEKDLVWKMRH
EVQERFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDSSFPDRHVGSFA
IKSLRKLTDDELFQYLLQLVQVLKYESYLDCXAKFXXXXXXRKIGHFLFWHLRSEMHVPS
VALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKSPKPQTKELLHLCM
RQETYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSEGSVGIIFK
NGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQL
NKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNI
MIRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGY
CERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKF
NEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3138 nt   +upstreamnt  +downstreamnt
atgcccccaggggttgactgccccatggaattctggaccaaggaggagaatcagaacgtg
acagtcgacttcttgctgcctacgggggtatacctgaacttccctgtgtcccgaaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgagcccagtttgagccgctgttccac
atgctcagtgaccccgaggcctatgtgttcacctgtgtcaaccagaccgcggagcagcag
gagctggaggacgagcagcggcggctgtgtgacatccagcccttcctgccagtcttacgc
ctggtggcccgtgagggcgacagggtgaagaagctcatcaactcgcagatcagccttctc
atcggcaaaggcctccacgagtttgactctttgcgcgacccagaagtgaacgactttcga
gccaagatgcgccagttctgcgaggaggcggccgcccgccgccagcagctgggctgggag
gcctggctgcagtacagcttccccctgcagctggagccctcggcacgcacctgggggcct
ggcactctgcgcgtccccaaccgcgccctcctggtcaacgtcaagttcgagggcagtgag
gagagcttcaccttccaggtgtccagcaaagacgtgcccctgtcgctgatggcctgcgcc
ctccggaagaaggccaccgtcttccggcagtccctggtggagcacgccgaggactatgcc
ctgcaggtgaacggcaggcacgagtacctgtacggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagcgggctgaccccccacctgacgatggtgcattgctcc
tctatcctcgccatgcgggacgagcagagcgaccccgccccccaagtccaaaagccgcgc
accaaaccgccccccatccccatgaagaagccctcctctgtgtccctgtggtccttggag
caacctttctgcatccagctgatccagggcagcaaagtgaacgccgacgagcggatgaag
ctggtggtgcaggcggggctgttccacggcaacgagacgctgtgcaagacggtgtccagc
tccgaggtgaacgtgtgctcggagcccgtgtggaagcagcgcctggagttcgacatcaac
gtctgcgacctgccacgcatggcccgcctctgcttcgcgctgtacgccgtcatcgagaag
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gctaacctcaccctgttcgactacaaggaccagctcaagacgggcgaatgctgcctctac
atgtggccctctgtcccagacgagaagggggagctgctgaacnnnnnnnnnnnnnnnnnn
nnnaccgtgcgcagcaaccccaacaccgagagtgctgccgccctggtcatctgtctcccc
gaggtggccccccaccccgtgtactaccctgccctggacaagatcctggagctgggacgg
cacggggagcacggccgcttcacggaggaggagcagctgcagctgcgggaaatcctggag
cggcgggcgtcgggggagctgtatgagcacgagaaggacctggtgtggaagatgcggcac
gaggtccaggagcgcttcccagaggcgctggctcggctgctgctggtcaccaagtggaac
aagcacgaggacgtggcccagatgctctacctgctctgctcctggcccgagctgcccgtc
ctgagcgccctggagctgctggactccagcttccccgaccgccacgtgggctccttcgcc
atcaagtccttgcggaagctaacggacgacgagctcttccaatacctgctgcagctggtg
caggtgctcaagtacgagtcctacctcgactgcngcgccaaattcnnnnnnnnnnnnnnn
nnccgcaagatcggccacttcctcttctggcacctccgctccgagatgcacgtgccgtcg
gtggccctgcgcttcggcctcatcatggaagcctactgcaggggcagcacccaccacatg
aaggtgctgatgaaacagggggaagcgctcagcaaactgaaggccctgaacgacttcgtc
aaagtgagctcccagaagagccccaagccccagaccaaggagctgctgcacctgtgcatg
cgccaggagacctacctggaggccctttcccacctgcagtccccgctcgatcccagcacc
ctgctggctgaagtctgtgtggagcagtgcaccttcatggactccaagatgaagccactg
tgggtcatgtacagcaacgaggaggcgggcagcgagggcagcgtgggcatcatcttcaag
aatggggacgacctccgccaggacatgctgactctgcagatgatccagctcatggacgtt
ctgtggaagcaggagggcttggacctgaggatgaccccctacggctgcctctccacgggg
gaccgcacgggcctcattgaggtggtgctgcactcggataccatcgccaacatccagctg
aacaagagcaacatggcagccacggccgccttcaacaaggacgccctgctcaactggctc
aagtctaagaaccccggggaggccctggatcgagccatcgaggagttcaccctctcctgc
gctggctactgtgtggccacctatgtgctgggcatcggagaccggcacagcgacaacatc
atgatccgtgagaacgggcagctcttccacatcgacttcggccactttctggggaatttc
aagaccaagtttggaatcaaccgtgagcgagtcccattcatcctcacctatgacttcgtc
catgtgatccagcaggggaagactaataacagtgagaaatttgaaaggttccggggctac
tgcgagagggcctacaccatcctgcggcgccacgggctgctcttcctccacctcttcgcc
ctgatgcgggcggcgggcctgcctgagctcagctgctccaaggacatccagtatctcaag
gactccctggcgttggggaagaccgaggaggaggcgctaaagcacttccgagtgaagttt
aacgaggcgctgcgggagagctggaaaaccaaagtgaactggctggcccacaacgtgtcc
aaagataacaggcaatag

KEGG   Pteropus alecto (black flying fox): 102891637
Entry
102891637         CDS       T02993                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04210  Apoptosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04218  Cellular senescence
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04620  Toll-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04668  TNF signaling pathway
pale04670  Leukocyte transendothelial migration
pale04722  Neurotrophin signaling pathway
pale04725  Cholinergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04926  Relaxin signaling pathway
pale04929  GnRH secretion
pale04930  Type II diabetes mellitus
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale04960  Aldosterone-regulated sodium reabsorption
pale04973  Carbohydrate digestion and absorption
pale05010  Alzheimer disease
pale05017  Spinocerebellar ataxia
pale05020  Prion disease
pale05100  Bacterial invasion of epithelial cells
pale05135  Yersinia infection
pale05142  Chagas disease
pale05146  Amoebiasis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102891637
   04014 Ras signaling pathway
    102891637
   04015 Rap1 signaling pathway
    102891637
   04370 VEGF signaling pathway
    102891637
   04630 JAK-STAT signaling pathway
    102891637
   04668 TNF signaling pathway
    102891637
   04066 HIF-1 signaling pathway
    102891637
   04068 FoxO signaling pathway
    102891637
   04070 Phosphatidylinositol signaling system
    102891637
   04072 Phospholipase D signaling pathway
    102891637
   04071 Sphingolipid signaling pathway
    102891637
   04024 cAMP signaling pathway
    102891637
   04151 PI3K-Akt signaling pathway
    102891637
   04152 AMPK signaling pathway
    102891637
   04150 mTOR signaling pathway
    102891637
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102891637
  09143 Cell growth and death
   04210 Apoptosis
    102891637
   04218 Cellular senescence
    102891637
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102891637
   04550 Signaling pathways regulating pluripotency of stem cells
    102891637
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102891637
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102891637
   04613 Neutrophil extracellular trap formation
    102891637
   04620 Toll-like receptor signaling pathway
    102891637
   04625 C-type lectin receptor signaling pathway
    102891637
   04650 Natural killer cell mediated cytotoxicity
    102891637
   04660 T cell receptor signaling pathway
    102891637
   04662 B cell receptor signaling pathway
    102891637
   04664 Fc epsilon RI signaling pathway
    102891637
   04666 Fc gamma R-mediated phagocytosis
    102891637
   04670 Leukocyte transendothelial migration
    102891637
   04062 Chemokine signaling pathway
    102891637
  09152 Endocrine system
   04910 Insulin signaling pathway
    102891637
   04923 Regulation of lipolysis in adipocytes
    102891637
   04929 GnRH secretion
    102891637
   04915 Estrogen signaling pathway
    102891637
   04914 Progesterone-mediated oocyte maturation
    102891637
   04917 Prolactin signaling pathway
    102891637
   04926 Relaxin signaling pathway
    102891637
   04935 Growth hormone synthesis, secretion and action
    102891637
   04919 Thyroid hormone signaling pathway
    102891637
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102891637
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102891637
  09156 Nervous system
   04725 Cholinergic synapse
    102891637
   04722 Neurotrophin signaling pathway
    102891637
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102891637
  09158 Development and regeneration
   04360 Axon guidance
    102891637
   04380 Osteoclast differentiation
    102891637
  09149 Aging
   04211 Longevity regulating pathway
    102891637
   04213 Longevity regulating pathway - multiple species
    102891637
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102891637
   05206 MicroRNAs in cancer
    102891637
   05205 Proteoglycans in cancer
    102891637
   05203 Viral carcinogenesis
    102891637
   05230 Central carbon metabolism in cancer
    102891637
   05231 Choline metabolism in cancer
    102891637
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102891637
  09162 Cancer: specific types
   05210 Colorectal cancer
    102891637
   05212 Pancreatic cancer
    102891637
   05225 Hepatocellular carcinoma
    102891637
   05226 Gastric cancer
    102891637
   05214 Glioma
    102891637
   05221 Acute myeloid leukemia
    102891637
   05220 Chronic myeloid leukemia
    102891637
   05218 Melanoma
    102891637
   05211 Renal cell carcinoma
    102891637
   05215 Prostate cancer
    102891637
   05213 Endometrial cancer
    102891637
   05224 Breast cancer
    102891637
   05222 Small cell lung cancer
    102891637
   05223 Non-small cell lung cancer
    102891637
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102891637
   05017 Spinocerebellar ataxia
    102891637
   05020 Prion disease
    102891637
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102891637
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102891637
   04932 Non-alcoholic fatty liver disease
    102891637
   04931 Insulin resistance
    102891637
   04933 AGE-RAGE signaling pathway in diabetic complications
    102891637
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102891637
   05100 Bacterial invasion of epithelial cells
    102891637
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102891637
   05170 Human immunodeficiency virus 1 infection
    102891637
   05161 Hepatitis B
    102891637
   05160 Hepatitis C
    102891637
   05171 Coronavirus disease - COVID-19
    102891637
   05164 Influenza A
    102891637
   05162 Measles
    102891637
   05168 Herpes simplex virus 1 infection
    102891637
   05163 Human cytomegalovirus infection
    102891637
   05167 Kaposi sarcoma-associated herpesvirus infection
    102891637
   05169 Epstein-Barr virus infection
    102891637
   05165 Human papillomavirus infection
    102891637
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102891637
   05142 Chagas disease
    102891637
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102891637
   01524 Platinum drug resistance
    102891637
   01522 Endocrine resistance
    102891637
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102891637
Membrane trafficking [BR:pale04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102891637
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 PI_PP_I DUF5638
Other DBs
NCBI-GeneID: 102891637
NCBI-ProteinID: XP_015450717
UniProt: L5K6I9
LinkDB
Position
Unknown
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPVTSAVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSKYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQYSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNTWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYGSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccgaag
ccacctaagccagtgacttcagccgttacaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattacgg
gatatgccagatggtaccttcttggtcagagatgcctcaacaaaaatgcagggagattat
actttgactttacggaagggaggcaataataaattaataaaaatctatcatcgagatggt
aaatacggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactat
catcatgaatctcttgctcagtacaatcccaaacttgatgtgaagctaatgtacccagtg
tccaaataccaacaggatcagttggtaaaagaagataacattgatgcagttggtaaaaaa
ctacaggagtatcactcccagtatcaggaaaagagtaaagagtatgacaggctatatgaa
gaatacacgagaacatctcaggaaatacagatgaagcggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcacacacaagaacaatatagcaaagaatat
attgagcgatttcgcagagaggggaatgaaaaggaaattgaacgaattatgatgaattat
gacaaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaacagtattaaacct
gacttgatccagctgcgcaagatccgagatcagcaccttgtatggcttaatcacaaagga
gtgagacagaagcgcctgaatacctggctgggaatcaagaatgaagatgctgatgagacc
tattttatcaatgaggaagatgaaaacctgccgcattatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacccgatggtgcattc
ttaattcgtgagagtagcaagaaaggatgttatgcttgctctgtggttgccgatggggaa
gtgaagcactgtgtgatctacagcactgctcggggctatggctttgcagagccctacaac
ctgtatggctcactgaaggagctggtgctccattaccagcagacatccctcgtccagcac
aacgactccctcaacgtcaggcttgcctaccctgtccacgcacagatgccctcgctctgc
agataa

DBGET integrated database retrieval system