KEGG   Pteropus alecto (black flying fox): 102879238
Entry
102879238         CDS       T02993                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00562  Inositol phosphate metabolism
pale01100  Metabolic pathways
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04062  Chemokine signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04310  Wnt signaling pathway
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04621  NOD-like receptor signaling pathway
pale04713  Circadian entrainment
pale04720  Long-term potentiation
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04728  Dopaminergic synapse
pale04730  Long-term depression
pale04742  Taste transduction
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04922  Glucagon signaling pathway
pale04924  Renin secretion
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04929  GnRH secretion
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04961  Endocrine and other factor-regulated calcium reabsorption
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04973  Carbohydrate digestion and absorption
pale05010  Alzheimer disease
pale05016  Huntington disease
pale05017  Spinocerebellar ataxia
pale05022  Pathways of neurodegeneration - multiple diseases
pale05142  Chagas disease
pale05143  African trypanosomiasis
pale05146  Amoebiasis
pale05163  Human cytomegalovirus infection
pale05200  Pathways in cancer
Module
pale_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102879238 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102879238 (PLCB3)
   04310 Wnt signaling pathway
    102879238 (PLCB3)
   04371 Apelin signaling pathway
    102879238 (PLCB3)
   04020 Calcium signaling pathway
    102879238 (PLCB3)
   04070 Phosphatidylinositol signaling system
    102879238 (PLCB3)
   04072 Phospholipase D signaling pathway
    102879238 (PLCB3)
   04071 Sphingolipid signaling pathway
    102879238 (PLCB3)
   04022 cGMP-PKG signaling pathway
    102879238 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102879238 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102879238 (PLCB3)
   04613 Neutrophil extracellular trap formation
    102879238 (PLCB3)
   04621 NOD-like receptor signaling pathway
    102879238 (PLCB3)
   04062 Chemokine signaling pathway
    102879238 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    102879238 (PLCB3)
   04922 Glucagon signaling pathway
    102879238 (PLCB3)
   04929 GnRH secretion
    102879238 (PLCB3)
   04912 GnRH signaling pathway
    102879238 (PLCB3)
   04915 Estrogen signaling pathway
    102879238 (PLCB3)
   04921 Oxytocin signaling pathway
    102879238 (PLCB3)
   04926 Relaxin signaling pathway
    102879238 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    102879238 (PLCB3)
   04918 Thyroid hormone synthesis
    102879238 (PLCB3)
   04919 Thyroid hormone signaling pathway
    102879238 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    102879238 (PLCB3)
   04916 Melanogenesis
    102879238 (PLCB3)
   04924 Renin secretion
    102879238 (PLCB3)
   04925 Aldosterone synthesis and secretion
    102879238 (PLCB3)
   04927 Cortisol synthesis and secretion
    102879238 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102879238 (PLCB3)
   04270 Vascular smooth muscle contraction
    102879238 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    102879238 (PLCB3)
   04971 Gastric acid secretion
    102879238 (PLCB3)
   04972 Pancreatic secretion
    102879238 (PLCB3)
   04973 Carbohydrate digestion and absorption
    102879238 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102879238 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102879238 (PLCB3)
   04725 Cholinergic synapse
    102879238 (PLCB3)
   04728 Dopaminergic synapse
    102879238 (PLCB3)
   04726 Serotonergic synapse
    102879238 (PLCB3)
   04720 Long-term potentiation
    102879238 (PLCB3)
   04730 Long-term depression
    102879238 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    102879238 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    102879238 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    102879238 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102879238 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102879238 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102879238 (PLCB3)
   05016 Huntington disease
    102879238 (PLCB3)
   05017 Spinocerebellar ataxia
    102879238 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    102879238 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102879238 (PLCB3)
   04934 Cushing syndrome
    102879238 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102879238 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102879238 (PLCB3)
   05142 Chagas disease
    102879238 (PLCB3)
   05143 African trypanosomiasis
    102879238 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102879238 (PLCB3)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102879238 (PLCB3)
Membrane trafficking [BR:pale04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102879238 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102879238 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y PH_14 EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 102879238
NCBI-ProteinID: XP_015444256
UniProt: L5KQC2
LinkDB
Position
Unknown
AA seq 1229 aa
MAGARPGVHALQLEPPTVVDILRRGSKFIKWDEEASSRNLVTLRVDSNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVTTSFLNF
MAVQDDTAKVWAEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLGPSQARQLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGTPLPSPQDLMGRILVKNKKRHRPSTGGTGS
SLRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEAGLEKPSLEPQKSLGE
EGPQRGPDLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPVK
FKSFEAARKRNKCFEMSSFVETKAMEHLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYMP
QLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIVD
GIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWEEEPF
DFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLIY
TEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGEREAQSGPETCQETQSQQLV
SQLTPNPTPSPLDTSPRRPPGPTTSPTSPSLSSPGQRDDLIASILSEVAVAPLEELRGHK
ALVKLQSRQERDLRELHKKHQRKAVALTRRLLDSLAQARAEGRCRPRPGVLGGENEKEEE
EEVKRFQEFQKRQVQSLLELREAQADTETERKLEHLRQAQQRLREIVLDAHTTQLKRLKE
TNDREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLEEAQKQ
RHERLMAGQQQVLQQLIEEEPKMLAQLTQECQEQRARLPQEIRRSLLGETREGLGDGHLV
ACASNGHAPGSSGHLSGADSETQEENTKL
NT seq 3690 nt   +upstreamnt  +downstreamnt
atggcgggcgccaggccgggcgtccacgcgctgcagttggagccgcccaccgtggtggac
atcctgcggcgcgggagtaagttcatcaaatgggacgaggaggcctccagtcggaacttg
gtgactctgcgtgtggactccaatggcttcttcctgtactggacaggacccaacatggag
gtggacacactggacatcagttccatcagggacacacgaacaggccgttatgcccgtctg
cccaaggaccccaagatacgggaagtgctgggttttgggggccctgatgcccggctggag
gagaagctgatgacagtggtggctgggccagacccagtgaccacatcgtttttgaacttc
atggccgtgcaggatgacacagccaaggtctgggccgaggagctgttcaaactggctatg
aacatcctggctcagaatgcctccaggaacaccttcctgcgcaaagcatacacaaagctg
aagctgcaggtgaaccaggatggacggatcccggtcaagaacatcctaaagatgttctca
gcagacaagaagcgggtggagactgcgctggagtcttgtggcctcaagtttaatcggagt
gagtccatccggcctgatgagttttccttggaaatcttcgagcggttcctgaataagctg
tgtctgcggccagacattgacaagatcctcctggagataggtgccaagggcaagccatac
ctgaccctggagcagctcatggacttcatcaaccaaaagcaacgggacccaagactcaat
gaagtgctgtacccacccctgggaccttcccaggcccggcagctaatcgagaagtatgag
cccaaccagcagttcctggagcgagaccagatgtccatggagggcttcagccgctacctg
ggaggtgaagagaacggcatcctgcccctagaggccctggatctgagtgcagacatgacc
cagccactgagtgcctatttcatcaactcctcacataacacctatctcacggcgggacag
ctggctgggacctcgtcggtggagatgtaccggcaggcactgctgtggggctgccgctgc
gtggagctggacgtgtggaaagggcggccgcctgaggaggagcccttcatcacccatggc
ttcaccatgaccacggaggtgccgctgcgggacgtgctcgaggccattgcggagactgcc
ttcaagacctcaccctaccccgtcatcctctccttcgagaaccacgtggactcggcgaag
cagcaggccaagatggctgagtattgccgctccatctttggggacgcgctgctcatcgac
ccactggacaagtacccgctggccccgggcaccccgctgcccagcccccaggacctgatg
ggccgcatcctggtgaagaacaagaagcggcaccgacccagcacgggcggcaccggtagc
tccttgcgcaagcggccgctggagcagagcaactcggccttgagcgagagctctgccgcc
accgagccctcctcaccccagctcgggtcccccagctccgacagctgccctggcttgagc
aatggggaggaggcaggccttgagaagcccagcctagagcctcagaagtctctgggcgag
gagggaccccagcggggccccgatcttggtccagccgatcgtgaggatgaggaggaggat
gaggaagaggaggaacagacagaccccaaaaaaccaaccacagatgagggcaccgccagc
agtgaggtcaatgccactgaggaaatgtcaacactcgtcaactacatcgaacctgtcaag
ttcaaatcctttgaggctgctcgaaagaggaacaagtgctttgagatgtcatccttcgtg
gagaccaaggctatggagcatctgaccaagagccccatggagttcgtggaatacaacaag
cagcagctcagccgtatctaccccaagggcacccgtgtggactcgtccaactacatgcca
cagctcttctggaacgtgggctgccagctcgtggcactcaacttccagaccctggatgtg
gcaatgcagctcaacgcaggtgtgttcgagtacaatgggcgcagtggctacctgctcaag
cctgagttcatgcggcggccggacaagtcctttgaccccttcaccgaggtcatcgtggac
ggcattgtggccaatgccttgcgggtcaaggtgatctctgggcagttcctgtccgacagg
aaggtgggcatctatgtagaggtggacatgttcggcctccctgttgacacgcggcgcaag
taccgcacgcggacctctcaggggaactcgttcaacccggtgtgggaggaggagcccttc
gacttccccaaggtggtgctgcctacgctggcttcgctgaggattgcagcttttgaggag
ggcggcaagtttgtggggcatcggatcctgcccgtctctgccatccgctcagggtaccac
tacatctgcctgcgaaacgaggccaaccagccactgtgcctgccagccctgctcatctac
actgaggcctctgactacatccctgacgaccaccaggattatgcagaagccctgatcaac
cccatcaagcacgtcagcctgatggaccagagggccaagcagctggctgccctcattggg
gagagggaggctcaatctggcccagagacatgccaggagacccagtcccagcagctggtg
tcccagctgaccccaaaccccacacccagcccactggacacctccccacgccgaccccca
ggccctaccacctcccccaccagcccctccctgagcagcccaggtcagcgggatgatctc
attgccagtattctctcagaggtggctgtagccccgctggaagagctccgaggccacaag
gctctggtgaagctccagagccggcaagagcgagacctgcgggagctgcacaagaagcat
cagcggaaggcggttgccctcactcgccgattgctggacagtctggcccaggcccgggct
gagggcaggtgccgacccaggccaggtgtcctagggggggagaacgagaaggaggaggag
gaggaggtgaaacggtttcaagagttccagaagagacaggtacagagtctgctggagctg
agggaggcacaggctgacacagagacagaacggaagctggagcacctgagacaggctcag
cagcggctcagggagattgtcctggatgctcacacaactcagctcaagaggctgaaggag
acaaatgacagggagaagaaggaactgcagaagatcctggacaggaaacgtcacaatagc
atctcagaggccaagacaagggagaaacataagaaggaggcggaactgacagagatcaac
cgtcggcacatcaccgagtcagtcaactccatccgtcggctggaggaggcccagaagcag
cggcatgaacgcctaatggcggggcagcagcaggtcctacagcagctcatagaagaggag
cccaagatgctggcccagctgacccaggagtgtcaggagcagcgggcgaggctgccccag
gagatccgccggagcctgctgggcgagacgcgagaggggctgggggacgggcatctggtg
gcttgtgccagcaacggtcatgcacctgggagcagcgggcacctgtctggcgctgactcg
gagacccaagaggagaatacgaagctctga

KEGG   Pteropus alecto (black flying fox): 102885207
Entry
102885207         CDS       T02993                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00562  Inositol phosphate metabolism
pale01100  Metabolic pathways
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04062  Chemokine signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04310  Wnt signaling pathway
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04621  NOD-like receptor signaling pathway
pale04713  Circadian entrainment
pale04720  Long-term potentiation
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04728  Dopaminergic synapse
pale04730  Long-term depression
pale04742  Taste transduction
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04922  Glucagon signaling pathway
pale04924  Renin secretion
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04929  GnRH secretion
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04961  Endocrine and other factor-regulated calcium reabsorption
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04973  Carbohydrate digestion and absorption
pale05010  Alzheimer disease
pale05016  Huntington disease
pale05017  Spinocerebellar ataxia
pale05022  Pathways of neurodegeneration - multiple diseases
pale05142  Chagas disease
pale05143  African trypanosomiasis
pale05146  Amoebiasis
pale05163  Human cytomegalovirus infection
pale05200  Pathways in cancer
Module
pale_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102885207 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102885207 (PLCB4)
   04310 Wnt signaling pathway
    102885207 (PLCB4)
   04371 Apelin signaling pathway
    102885207 (PLCB4)
   04020 Calcium signaling pathway
    102885207 (PLCB4)
   04070 Phosphatidylinositol signaling system
    102885207 (PLCB4)
   04072 Phospholipase D signaling pathway
    102885207 (PLCB4)
   04071 Sphingolipid signaling pathway
    102885207 (PLCB4)
   04022 cGMP-PKG signaling pathway
    102885207 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102885207 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102885207 (PLCB4)
   04613 Neutrophil extracellular trap formation
    102885207 (PLCB4)
   04621 NOD-like receptor signaling pathway
    102885207 (PLCB4)
   04062 Chemokine signaling pathway
    102885207 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    102885207 (PLCB4)
   04922 Glucagon signaling pathway
    102885207 (PLCB4)
   04929 GnRH secretion
    102885207 (PLCB4)
   04912 GnRH signaling pathway
    102885207 (PLCB4)
   04915 Estrogen signaling pathway
    102885207 (PLCB4)
   04921 Oxytocin signaling pathway
    102885207 (PLCB4)
   04926 Relaxin signaling pathway
    102885207 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    102885207 (PLCB4)
   04918 Thyroid hormone synthesis
    102885207 (PLCB4)
   04919 Thyroid hormone signaling pathway
    102885207 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    102885207 (PLCB4)
   04916 Melanogenesis
    102885207 (PLCB4)
   04924 Renin secretion
    102885207 (PLCB4)
   04925 Aldosterone synthesis and secretion
    102885207 (PLCB4)
   04927 Cortisol synthesis and secretion
    102885207 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102885207 (PLCB4)
   04270 Vascular smooth muscle contraction
    102885207 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    102885207 (PLCB4)
   04971 Gastric acid secretion
    102885207 (PLCB4)
   04972 Pancreatic secretion
    102885207 (PLCB4)
   04973 Carbohydrate digestion and absorption
    102885207 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102885207 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102885207 (PLCB4)
   04725 Cholinergic synapse
    102885207 (PLCB4)
   04728 Dopaminergic synapse
    102885207 (PLCB4)
   04726 Serotonergic synapse
    102885207 (PLCB4)
   04720 Long-term potentiation
    102885207 (PLCB4)
   04730 Long-term depression
    102885207 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    102885207 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    102885207 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    102885207 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102885207 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885207 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102885207 (PLCB4)
   05016 Huntington disease
    102885207 (PLCB4)
   05017 Spinocerebellar ataxia
    102885207 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    102885207 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102885207 (PLCB4)
   04934 Cushing syndrome
    102885207 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102885207 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102885207 (PLCB4)
   05142 Chagas disease
    102885207 (PLCB4)
   05143 African trypanosomiasis
    102885207 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102885207 (PLCB4)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102885207 (PLCB4)
Membrane trafficking [BR:pale04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102885207 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102885207 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 102885207
NCBI-ProteinID: XP_006921659
LinkDB
Position
Unknown
AA seq 1194 aa
MAKPYEFNWQKEVPSFLQEGAIFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSVRLGATPKDPKILAALEAVGKSENDLEGRIVCVCSGADLVNISFTYMVAENPE
VTKQWVDGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGVISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGRSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEQKQLEALKSM
MEAGESAAPVNILEDDNEEEVENAEQEEEAHPEYKFGNELSADDLGHKEAVANSVKKGLI
TVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAA
LASGMEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ
VDKIVAQYDKEKSTHEKTLEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNVN
NT seq 3585 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcaaaaggaagttccttcctttttgcaagaagga
gcaatttttgacagatatgaagaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggatgaatttggcttctttctgacctggaaaagtgaaggcaaggaaggacaagtgcta
gaatgctccctcatcaacagtgttcggttgggagccacaccaaaggatcccaaaatcctg
gctgctcttgaagctgttggaaaatccgaaaatgatctggaagggcggatagtttgtgtc
tgcagtggtgcagatctggtgaacatcagtttcacttacatggtggctgagaatccagaa
gtaactaagcaatgggtagacggcctgagatcaatcatacacaacttcagggccaacaac
gtcagtccaatgacatgcctcaagaaacactggatgaaattggcatttatgaccaacaca
aatggtaaaattccagttaggagtattactagaacctttgcatcggggaaaacagaaaag
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cctgcagcatttacttatgaaaagttctatgaactgacacaaaaaatttgtcctcggaca
gatatagaggatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcgactgaatgaaattttattc
ccattttatgatgctaaaagggcaatgcagatcattgagatgtatgagcctgatgaagac
ttaaagaaaaaaggcgtcatatcaagtgacggattttgcagatatctgatgtcagatgaa
aatgcccccgtctttctagatcgtttagaactttaccaagaaatggaccatcctctggct
cactacttcatcagctcttcccacaacacctatctcactggccgacaatttggtgggagg
tcttcggtggaaatgtacagacaggttctcctggccgggtgcagatgtgtcgaacttgac
tgttgggatggaaaaggtgaagaccaagaaccaataataactcatggaaaagcaatgtgt
acagatatcctttttaaagatgttattcaggccatcaaggaaacagcatttgtcacatct
gaatatccagtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggggatctcctgttgaaacaagcacttgaatcacat
ccacttgaaccaggcaggcccttgccatcccccaatgacctcaaaagaaaaatactcata
aaaaataaacggctgaaacctgaagttgaacaaaaacagcttgaagctttgaaaagcatg
atggaagctggagaatccgctgccccggttaacatcttagaggatgataatgaagaagaa
gtagaaaatgctgagcaagaggaagaagctcaccctgaatacaaatttggaaatgaactt
tctgcagatgacttgggtcacaaggaagctgttgcaaatagtgtcaagaagggcctgatt
actgtagaagatgagcaggcgtggatggcatcttataaatacgtaggtgctaccactaat
atccatccatatttgtccacaatgatcaactatgcacagcctgtaaagtttcaaggtttc
catgtggctgaagaacgcaatattcattataacatgtcttcttttaatgagtcagtcggt
ctaggctacttgaagacacacgcgattgaatttgtgaattataacaaacggcaaatgagt
cgcatttaccccaagggaggccgagtcgattccagtaattacatgcctcagattttctgg
aacgctggctgccagatggtttcactgaactatcaaaccccagatttagcgatgcaattg
aatcagggaaaatttgaatataatggatcatgcgggtaccttctcaaaccggatttcatg
aggcggcctgatcgaacatttgatcccttctctgaaactcctgttgacggtgttattgca
gccacttgctcagtgcaggtcatatcaggtcagttcttatcagataagaaaattggcaca
tatgtagaagtggatatgtatgggttgcccaccgacactatacgtaaggaatttcgaact
cgcatggtgatgaacaatggactcaatccagtttacaatgaagaatcatttgtatttcgg
aaggtaatcctccctgacctggcagtcttgagaatagcagtgtatgatgacaacaacaag
ctgattggccagaggattcttccactggatggccttcaggcaggctatcgacacatttct
cttcgaaatgagggaaataaaccattatcactgccaacaattttctgcaatattgttctt
aaaacatacgtgcctgatggatttggagatattgtggatgctttatcagatccaaagaag
tttctttcaattacggaaaagagggcggaccaaatgagagctatgggcattgaaaccagt
gacatagctgatgtgcccagtgacacttctaagaatgacaagaaaggaaaggccaacact
gccaaagcaaatgtgaccccacagagcagctctgagctcagaccaaccaccacagccgcc
ctggcgtctggcatggaagccaaaaaaggtatcgaacttatccctcaagtgaggatagaa
gatttaaagcaaatgaaggcttacttgaagcatttaaagaaacaacagaaggagctaaat
tctttaaagaagaagcatgcaaaggagcacagtaccatgcagaagttacattgcacacaa
gttgacaaaattgtggcacaatatgacaaagagaagtcgactcatgagaaaaccctagag
aaggcaatgaagaagaaggggggaagtaattgtcttgaaatgaaaaaagaaacagaaatt
aaaattcagacattgacatcagatcacaaatctaaggtcaaagagattgtggcacagcac
acaaaggaatggtcagaaatgatcaacacccacagtgctgaggagcaagaaatccgggac
ctgcacctcagccagcagtgtgagctgctgaaaaagctcctgatcaacgcccacgagcag
caaacccagcagctgaaattgtcccacgacagagaaagcaaggaaatgagagcacaccaa
gctaagatttctatggaaaatagcaaagccatcagccaagataaatctatcaagaataaa
gcagaacgggaaaggcgagttagggagttaaacagcagcaacactaagaagtttctggaa
gaaagaaagagacttgcaatgaaacagtccaaagaaatggatcagttgaaaaaagtccag
cttgaacacctagaattcctagagaaacagaatgaacagcttttgaaatcctgtcatgca
gtgtcccaaactcaaggcgaaggagatgcagcagatggtgaaattggaagccgagatgga
ccgcagaccagcaacagtagtatgaaactccaaaacgtaaactga

KEGG   Pteropus alecto (black flying fox): 102885781
Entry
102885781         CDS       T02993                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00562  Inositol phosphate metabolism
pale01100  Metabolic pathways
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04062  Chemokine signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04310  Wnt signaling pathway
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04621  NOD-like receptor signaling pathway
pale04713  Circadian entrainment
pale04720  Long-term potentiation
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04728  Dopaminergic synapse
pale04730  Long-term depression
pale04742  Taste transduction
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04922  Glucagon signaling pathway
pale04924  Renin secretion
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04929  GnRH secretion
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04961  Endocrine and other factor-regulated calcium reabsorption
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04973  Carbohydrate digestion and absorption
pale05010  Alzheimer disease
pale05016  Huntington disease
pale05017  Spinocerebellar ataxia
pale05022  Pathways of neurodegeneration - multiple diseases
pale05142  Chagas disease
pale05143  African trypanosomiasis
pale05146  Amoebiasis
pale05163  Human cytomegalovirus infection
pale05200  Pathways in cancer
Module
pale_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102885781 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102885781 (PLCB1)
   04310 Wnt signaling pathway
    102885781 (PLCB1)
   04371 Apelin signaling pathway
    102885781 (PLCB1)
   04020 Calcium signaling pathway
    102885781 (PLCB1)
   04070 Phosphatidylinositol signaling system
    102885781 (PLCB1)
   04072 Phospholipase D signaling pathway
    102885781 (PLCB1)
   04071 Sphingolipid signaling pathway
    102885781 (PLCB1)
   04022 cGMP-PKG signaling pathway
    102885781 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102885781 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102885781 (PLCB1)
   04613 Neutrophil extracellular trap formation
    102885781 (PLCB1)
   04621 NOD-like receptor signaling pathway
    102885781 (PLCB1)
   04062 Chemokine signaling pathway
    102885781 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    102885781 (PLCB1)
   04922 Glucagon signaling pathway
    102885781 (PLCB1)
   04929 GnRH secretion
    102885781 (PLCB1)
   04912 GnRH signaling pathway
    102885781 (PLCB1)
   04915 Estrogen signaling pathway
    102885781 (PLCB1)
   04921 Oxytocin signaling pathway
    102885781 (PLCB1)
   04926 Relaxin signaling pathway
    102885781 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    102885781 (PLCB1)
   04918 Thyroid hormone synthesis
    102885781 (PLCB1)
   04919 Thyroid hormone signaling pathway
    102885781 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    102885781 (PLCB1)
   04916 Melanogenesis
    102885781 (PLCB1)
   04924 Renin secretion
    102885781 (PLCB1)
   04925 Aldosterone synthesis and secretion
    102885781 (PLCB1)
   04927 Cortisol synthesis and secretion
    102885781 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102885781 (PLCB1)
   04270 Vascular smooth muscle contraction
    102885781 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    102885781 (PLCB1)
   04971 Gastric acid secretion
    102885781 (PLCB1)
   04972 Pancreatic secretion
    102885781 (PLCB1)
   04973 Carbohydrate digestion and absorption
    102885781 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102885781 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102885781 (PLCB1)
   04725 Cholinergic synapse
    102885781 (PLCB1)
   04728 Dopaminergic synapse
    102885781 (PLCB1)
   04726 Serotonergic synapse
    102885781 (PLCB1)
   04720 Long-term potentiation
    102885781 (PLCB1)
   04730 Long-term depression
    102885781 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    102885781 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    102885781 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    102885781 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102885781 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885781 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102885781 (PLCB1)
   05016 Huntington disease
    102885781 (PLCB1)
   05017 Spinocerebellar ataxia
    102885781 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    102885781 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102885781 (PLCB1)
   04934 Cushing syndrome
    102885781 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102885781 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102885781 (PLCB1)
   05142 Chagas disease
    102885781 (PLCB1)
   05143 African trypanosomiasis
    102885781 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102885781 (PLCB1)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102885781 (PLCB1)
Membrane trafficking [BR:pale04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102885781 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102885781 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 102885781
NCBI-ProteinID: XP_006921662
LinkDB
Position
Unknown
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSAIVTPIILRSDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHARAPKDPKLRELLDVGNIGRLEHRMITVVYGVDLVNISYLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQDDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNSSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSNKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRILPVPAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTSLVPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKTARKDSKKKSEPSSPDHGSSMIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPSSLTSEPGKLNHRPPSS
EELEGDHPGREFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggggctcagcccggagtgcacgctttgcaactcaagcccgtgtgtgtgtccgac
agcctaaagaagggcacgaaattcgtcaagtgggatgatgactctgctattgttactcca
attattttgaggtctgaccctcagggatttttcttttactggacagatcaaaacaaggag
acggaactattagatctcagccttgtcaaggatgccaggtgtgggaaacatgccagagct
cccaaggaccccaaattacgtgaacttttggatgtggggaacattggacgcctggaacat
cgcatgataaccgtggtgtacggggttgacttagttaacatctcctatttgaaccttgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggctcaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgcattcctctcaaaaacatataccgcttgttttcagca
gaccggaaacgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgat
tcaatacctcaagatgatttcactccagaagtatacagagttttcctgaacaacctttgc
cctcgacctgaaattgataacatcttttctgaatttggtgccaaaagcaaaccatatctt
accgttgatcagatgatggattttatcaaccttaagcaacgagatcccaggctaaatgaa
atactctatccacctttaaagcaagagcaagttcaagtattgattgagaagtatgaacca
aacagtagcctcgccaaaaaaggacagatatcagtggatggatttatgcgctatctgagt
ggagaagaaaatggagttgtttcacctgagaaactggatttgaatgaagatatgtctcaa
cccctttctcactatttcattaattcctcacacaacacctacctcacagctggccagctg
gctggaaactcttctgtggagatgtatcgccaagtcctcctgtctggttgtcgctgtgta
gagctggactgctggaaaggacggactgcagaagaggagccagtcattacccacggcttc
accatgaccaccgaaatatccttcaaggaggtgatagaagcaatcgctgagtgtgcattt
aagacttcaccgtttccgattcttctttcctttgagaatcacgtggactccccaaagcag
caagccaagatggcagagtattgccgactgatctttggggatgcccttctcatggagcca
ctggaaaaatacccactggaatctggagttcctcttccaagccctatggatttaatgtac
aaaattttggtgaaaaataagaagaaatcgcacaagtcatcagaaggaagcaacaaaaag
aagctctcagaacaagcctccaacacttacagcgactcttccagtgtgtttgagccctcg
tcccctggggcaggggaagctgatacagagagtgacgatgacgatgatgatgatgactgt
aaaaaatcttcaatggatgaggggactgctgggagcgaggctatggccacagaagagatg
tctaacctggtgaactatattcagccagtcaagtttgagtcatttgaaatttcaaaaaaa
agaaatagaagttttgaaatgtcttcttttgtggaaaccaaaggacttgagcaactgacg
aagtctccagtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatctaactatatgcctcagctcttctggaacgcgggttgtcaa
atggtcgcacttaacttccagacgatggacctggctatgcagataaacatggggatgtat
gaatacaatgggaaaagtggctacagattaaagccagagttcatgaggagacctgacaag
catttcgatccattcaccgaaggcattgtagatgggatagtggccaacactttatctgtt
aagattatttcaggtcaatttctttctgataagaaagttgggacttacgtggaagtagat
atgtttggcttgcctgtagacacaaggaggaaagcgtttaagaccaagacatcacaagga
aatgctgtaaatcctgtctgggaagaagaacccattgtgttcaaaaaggtggttcttcct
tctctggcctgtctgaggatagcagtttatgaggaaggaggtaaatttattggtcaccgg
atcttgccagtaccagcaattcggccaggctatcactacatctgtctgaggaatgagagg
aaccaacctctgacgctaccagctgtctttgtctacatagaggtgaaagactatgtccca
gatacatatgcagatgtgattgaagctttgtcaaatccaattcgatatgtaaatctgatg
gagcagagagctaagcaactggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggggagacaccgtcagaggctccaagtgaagccaggacaactccagca
gaaaatggagtaaatcacactacatccctggtacccaaaccaccttctcaggctctccac
agccaacctgctccaggttctgtaaaggcacctgccaagacagaagatcttattcagagt
gttttaacagaagtggaagcacagactattgaagagctaaagcaacagaaatcgtttgtg
aaacttcaaaagaagcactacaaagaaatgaaagatctggttaagagacaccacaagaaa
accactgaccttatcaaagaacacactacaaaatataatgaaattcagaatgactacttg
agaaggagagcagctttagaaaagacagccagaaaggatagtaagaaaaaatcagaaccc
agcagccctgaccatggttcatcgatgattgagcaagatcttgctgccctggatgctgaa
atgacccaaaagttaatagacttaaaggacaagcaacagcaacagctgctgaatcttcga
caagaacagtattatagtgaaaagtaccagaagcgagaacatattaaactgcttattcaa
aaactgacggatgttgctgaagaatgtcagaacaatcagttaaagaagcttaaagaaatc
tgtgagaaagagaagaaggaattaaagaagaaaatggataagaagaggcaggagaagata
acagaagctaaatccaaagacaaaagccagatggaagaggaaaagacggagatgatccgg
tcatacatccaggaggtggtgcagtacatcaagaggttagaagaggcacaaagtaaaagg
caagaaaaacttgtagagaaacacaaggagatacgtcagcagatcctggacgaaaagccc
aagctgcaggtggagctagagcaagagtaccaagataagttcaaaagactgcctctggag
attttggagtttgtgcaggaagccatgaaggggaagatcagtgaggacagtaatcacagt
tctgccccttcctccttgacctcagagcctggaaaactgaaccacaggcctccctccagt
gaggagctggaaggagaccacccaggaagagagtttgatactcctctgtga

KEGG   Pteropus alecto (black flying fox): 102885953
Entry
102885953         CDS       T02993                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00562  Inositol phosphate metabolism
pale01100  Metabolic pathways
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04062  Chemokine signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04310  Wnt signaling pathway
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04621  NOD-like receptor signaling pathway
pale04713  Circadian entrainment
pale04720  Long-term potentiation
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04728  Dopaminergic synapse
pale04730  Long-term depression
pale04742  Taste transduction
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04922  Glucagon signaling pathway
pale04924  Renin secretion
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04929  GnRH secretion
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04961  Endocrine and other factor-regulated calcium reabsorption
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04973  Carbohydrate digestion and absorption
pale05010  Alzheimer disease
pale05016  Huntington disease
pale05017  Spinocerebellar ataxia
pale05022  Pathways of neurodegeneration - multiple diseases
pale05142  Chagas disease
pale05143  African trypanosomiasis
pale05146  Amoebiasis
pale05163  Human cytomegalovirus infection
pale05200  Pathways in cancer
Module
pale_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102885953 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102885953 (PLCB2)
   04310 Wnt signaling pathway
    102885953 (PLCB2)
   04371 Apelin signaling pathway
    102885953 (PLCB2)
   04020 Calcium signaling pathway
    102885953 (PLCB2)
   04070 Phosphatidylinositol signaling system
    102885953 (PLCB2)
   04072 Phospholipase D signaling pathway
    102885953 (PLCB2)
   04071 Sphingolipid signaling pathway
    102885953 (PLCB2)
   04022 cGMP-PKG signaling pathway
    102885953 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102885953 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102885953 (PLCB2)
   04613 Neutrophil extracellular trap formation
    102885953 (PLCB2)
   04621 NOD-like receptor signaling pathway
    102885953 (PLCB2)
   04062 Chemokine signaling pathway
    102885953 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    102885953 (PLCB2)
   04922 Glucagon signaling pathway
    102885953 (PLCB2)
   04929 GnRH secretion
    102885953 (PLCB2)
   04912 GnRH signaling pathway
    102885953 (PLCB2)
   04915 Estrogen signaling pathway
    102885953 (PLCB2)
   04921 Oxytocin signaling pathway
    102885953 (PLCB2)
   04926 Relaxin signaling pathway
    102885953 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    102885953 (PLCB2)
   04918 Thyroid hormone synthesis
    102885953 (PLCB2)
   04919 Thyroid hormone signaling pathway
    102885953 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    102885953 (PLCB2)
   04916 Melanogenesis
    102885953 (PLCB2)
   04924 Renin secretion
    102885953 (PLCB2)
   04925 Aldosterone synthesis and secretion
    102885953 (PLCB2)
   04927 Cortisol synthesis and secretion
    102885953 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102885953 (PLCB2)
   04270 Vascular smooth muscle contraction
    102885953 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    102885953 (PLCB2)
   04971 Gastric acid secretion
    102885953 (PLCB2)
   04972 Pancreatic secretion
    102885953 (PLCB2)
   04973 Carbohydrate digestion and absorption
    102885953 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102885953 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102885953 (PLCB2)
   04725 Cholinergic synapse
    102885953 (PLCB2)
   04728 Dopaminergic synapse
    102885953 (PLCB2)
   04726 Serotonergic synapse
    102885953 (PLCB2)
   04720 Long-term potentiation
    102885953 (PLCB2)
   04730 Long-term depression
    102885953 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    102885953 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    102885953 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    102885953 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102885953 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885953 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102885953 (PLCB2)
   05016 Huntington disease
    102885953 (PLCB2)
   05017 Spinocerebellar ataxia
    102885953 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    102885953 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102885953 (PLCB2)
   04934 Cushing syndrome
    102885953 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102885953 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102885953 (PLCB2)
   05142 Chagas disease
    102885953 (PLCB2)
   05143 African trypanosomiasis
    102885953 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102885953 (PLCB2)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102885953 (PLCB2)
Membrane trafficking [BR:pale04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102885953 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102885953 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 Gp58 AAA_13
Other DBs
NCBI-GeneID: 102885953
NCBI-ProteinID: XP_006920659
LinkDB
Position
Unknown
AA seq 1152 aa
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKIPKSQKLRDVFNMDFPDNNFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKDWAEDVLALVKHPLTANAPRITFLDKILVKLKMQLNPEGKIPVKNSLALSACHLPK
GKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHSKAKPYMTKEHLTTFINQKQRDS
RLNSVLFPKARSDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLCGPENSVLAQDKLLLHH
DMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDCWKGKPPDEEPII
THGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKMAEYCRVMFGDML
LTEPLEKFPLKPGTPLPSPEDLRGKILIKNKKNQFSGSASPSTEQPGGEAEGSCPPSAPV
GGDTVWTGEEGAELEEEVEEEEESGSLDEEEIKKLQSDEGTAGLEVTAYEEMSSLVNYIQ
PAKFISFEFSAQKNRSYVISSFTELKAYDLLSKATVQFVDYNKRQMSRIYPKGTRMDSSN
YMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFMRRPDKQYNPFSVD
RIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRTKLSPSTNSINPVWK
EEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHLCLHSESNMPLTMPS
LFVFLELKDYVPDRWADLTVALTNPIKFFSAQDKKSVKLKEATGGPPEKPFPLGSPAASQ
VNGAAAPTSNGSAELRTTSPEELRESKGVVKLQRRHEKELRELERRGARRWEELLQRGTA
QLAELGPLGAEVGCGGRRLGPGKGSRKKRTLPCEENAGAAPGEGPEGTDLRVRELRDRLE
LELLQQGEEQYECILKRKEQHVAEQITKMMELAREKQAAELKTLKETSESDTKEMKKKLE
AKRLERIQAMVKVTTDKMAQERLKREINDSHIQDVVQVVEQMTENLRRHQEKLEEKQAAC
LEQIREMEKQFQQEALTEYEARMKGLEAEVKESLKTCFRACFPSETEDKPETPCGASGEL
CEQDPLTAKIDT
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgttgccccccaaggtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggacgatgaaacaacgatagcctccccggttatcctccgtgtg
gaccccaagggctattacttatactggacatatcagagtaaggagatggagtttctggat
atcaccagcatccgcgacacccgctttgggaagtttgccaagattcccaagagccagaag
ctccgggatgtcttcaacatggactttcctgacaacaacttcctgctgaagacacttact
gtggtgtctggccccgacatggtggacctcaccttccacaactttgtctcctacaaggag
aacgtgggcaaggactgggctgaagatgtactggctctggtcaagcatccgctgacagct
aatgccccccgcattaccttcctggacaagatcctggtgaagctcaagatgcagctcaac
cctgaagggaagattcctgtgaagaactctcttgccctcagtgcctgccacctccccaaa
gggaagaatgatgccatcaatcctgaggacttcccagagtctgtctacaagagtttcctc
atgagcctctgtcctcggccagaaatagatgagatcttcacttcctaccattccaaggcc
aaaccctacatgaccaaggagcacttgaccacattcatcaaccagaaacagagggactcc
cgcctcaactccgtactgtttccgaaagcacggtctgaccaggtgcagggcctcattgac
aagtatgagcccagtggtatcaacgtgcagaggggccagctgtcacctgagggcatggta
tggtttctctgtgggcctgagaatagtgtgctggcccaggacaagctgctgctccaccat
gacatgacacagccactcaatcattacttcatcaactcctcacacaacacctacctgaca
gctggccagttctcaggcctttcctcggctgagatgtatcgccaggtgctgctagctggc
tgccgctgtgtggagctggactgctggaaggggaagccccccgatgaggagcctattatc
acccatggcttcaccatgaccacagatatttacttcaaggaagcaattgaagcgattgca
gaaagtgcctttaagacctccccatatcctgtcattctgtcatttgaaaaccacgtggac
tcaccccgccaacaagccaagatggccgagtactgccgggtgatgtttggcgatatgctg
ctcacagagcccctggaaaagttccctctgaaaccaggcacccccctgcccagcccagag
gatctccgtggcaagatcctcatcaagaataagaagaatcagttttctggctcagcatcc
cccagcacagagcagccaggtggagaggctgagggcagctgcccacccagtgcccctgtg
ggtggagacacagtgtggaccggtgaggaaggggctgagctggaggaggaggtggaagag
gaagaggagtcgggaagcctggatgaagaagagataaagaagttgcagtcagatgagggc
acagcgggcctggaggtgacagcttatgaggagatgtccagcctagtcaactacattcag
cccgccaagttcatctccttcgagttctctgcccagaagaaccgaagttatgtcatctcc
tcattcaccgagctcaaggcttatgatctgctctccaaggccacagtgcagtttgtggac
tacaacaagcgccagatgagccgcatttatcccaagggaacccgcatggactcctccaac
tacatgccccagatgttttggaatgctggttgccagatggtcgccctcaacttccagacg
atggacctgcctatgcagcagaacatggcgctgtttgagttcaatgggcagagcggctac
ctcctcaagcatgagtttatgcgtcggccggacaagcagtacaacccattctcagtggac
cgcattgacgtggtggtagccaccaccctttccattacggtaatctctgggcagttcctg
tcagaacgcagtgtgcgcacctatgtggaagtggagctgtttggccttcctggggacccc
aagcggcgctatcgcaccaagctgtcgcccagtaccaactccatcaaccctgtctggaag
gaggagccctttgtctttgagaagatcttgatgcctgagttggcctccctcagggtggct
gtgatggaggaaggcaacaagtttctcggacaccgcatcatccccatcaatgccctgaat
tctggataccaccatctgtgcctgcacagcgagagcaacatgcccctcaccatgccttca
ctctttgtcttcctggaattgaaggactatgtacctgacaggtgggcagatctcaccgtg
gcccttaccaatcccatcaagttcttcagtgcccaagataagaagtctgtgaagctcaag
gaagccacgggaggtccgcctgagaagcctttccctctggggagtccagctgccagccag
gtcaatggggcagctgccccaacaagcaatggatcagcagagctgcggaccaccagcccg
gaggagctacgagagtcgaagggcgtcgtgaagctgcagcggcggcatgagaaggaactg
cgagagcttgagcggcgcggtgcgcggcgctgggaggagctgctgcagaggggcaccgcg
cagctggcggagcttgggccactgggcgcggaggtcggctgcgggggccgtaggctcggt
ccgggcaagggctcccgcaagaaaaggactctgccctgcgaggagaatgctggggcagca
ccgggtgagggtcccgagggcacggacctgcgtgtgcgcgagctgagggacaggctggag
ctggagctgctgcagcagggcgaggagcaatacgagtgtatcctgaagcgcaaggagcag
cacgtggccgagcaaatcaccaagatgatggagctggctagagagaaacaggctgcagag
cttaagactctcaaggagacctcagagagtgacactaaagagatgaagaaaaagctggag
gccaagaggctggagcggatccaggccatggtcaaggttaccacggacaagatggcccag
gagaggttgaaaagagagattaacgactcccatatccaggacgtggtgcaggtcgtcgaa
cagatgacagagaacctgaggaggcatcaggagaagctggaggagaagcaggcagcttgc
ctggaacagatccgggagatggaaaagcagttccagcaggaggcactgacagaatatgag
gccaggatgaagggcctggaggctgaggtgaaggagtcattgaagacctgcttcagggcg
tgcttcccttctgagactgaggacaagcctgagaccccctgtggggcctctggggagctg
tgtgaacaggacccacttacagcaaaaatagacacctaa

DBGET integrated database retrieval system