KEGG   Pteropus alecto (black flying fox): 102879337
Entry
102879337         CDS       T02993                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04210  Apoptosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04218  Cellular senescence
pale04261  Adrenergic signaling in cardiomyocytes
pale04370  VEGF signaling pathway
pale04371  Apelin signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04620  Toll-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04668  TNF signaling pathway
pale04722  Neurotrophin signaling pathway
pale04725  Cholinergic synapse
pale04728  Dopaminergic synapse
pale04910  Insulin signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04920  Adipocytokine signaling pathway
pale04922  Glucagon signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04926  Relaxin signaling pathway
pale04929  GnRH secretion
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale04973  Carbohydrate digestion and absorption
pale05010  Alzheimer disease
pale05017  Spinocerebellar ataxia
pale05132  Salmonella infection
pale05135  Yersinia infection
pale05142  Chagas disease
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102879337 (AKT3)
   04012 ErbB signaling pathway
    102879337 (AKT3)
   04014 Ras signaling pathway
    102879337 (AKT3)
   04015 Rap1 signaling pathway
    102879337 (AKT3)
   04370 VEGF signaling pathway
    102879337 (AKT3)
   04371 Apelin signaling pathway
    102879337 (AKT3)
   04630 JAK-STAT signaling pathway
    102879337 (AKT3)
   04668 TNF signaling pathway
    102879337 (AKT3)
   04066 HIF-1 signaling pathway
    102879337 (AKT3)
   04068 FoxO signaling pathway
    102879337 (AKT3)
   04072 Phospholipase D signaling pathway
    102879337 (AKT3)
   04071 Sphingolipid signaling pathway
    102879337 (AKT3)
   04024 cAMP signaling pathway
    102879337 (AKT3)
   04022 cGMP-PKG signaling pathway
    102879337 (AKT3)
   04151 PI3K-Akt signaling pathway
    102879337 (AKT3)
   04152 AMPK signaling pathway
    102879337 (AKT3)
   04150 mTOR signaling pathway
    102879337 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102879337 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    102879337 (AKT3)
   04218 Cellular senescence
    102879337 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102879337 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102879337 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102879337 (AKT3)
   04613 Neutrophil extracellular trap formation
    102879337 (AKT3)
   04620 Toll-like receptor signaling pathway
    102879337 (AKT3)
   04625 C-type lectin receptor signaling pathway
    102879337 (AKT3)
   04660 T cell receptor signaling pathway
    102879337 (AKT3)
   04662 B cell receptor signaling pathway
    102879337 (AKT3)
   04664 Fc epsilon RI signaling pathway
    102879337 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    102879337 (AKT3)
   04062 Chemokine signaling pathway
    102879337 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102879337 (AKT3)
   04922 Glucagon signaling pathway
    102879337 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    102879337 (AKT3)
   04920 Adipocytokine signaling pathway
    102879337 (AKT3)
   04929 GnRH secretion
    102879337 (AKT3)
   04915 Estrogen signaling pathway
    102879337 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    102879337 (AKT3)
   04917 Prolactin signaling pathway
    102879337 (AKT3)
   04926 Relaxin signaling pathway
    102879337 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    102879337 (AKT3)
   04919 Thyroid hormone signaling pathway
    102879337 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102879337 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102879337 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    102879337 (AKT3)
   04728 Dopaminergic synapse
    102879337 (AKT3)
   04722 Neurotrophin signaling pathway
    102879337 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102879337 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    102879337 (AKT3)
   04213 Longevity regulating pathway - multiple species
    102879337 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102879337 (AKT3)
   05205 Proteoglycans in cancer
    102879337 (AKT3)
   05230 Central carbon metabolism in cancer
    102879337 (AKT3)
   05231 Choline metabolism in cancer
    102879337 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102879337 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102879337 (AKT3)
   05212 Pancreatic cancer
    102879337 (AKT3)
   05225 Hepatocellular carcinoma
    102879337 (AKT3)
   05226 Gastric cancer
    102879337 (AKT3)
   05214 Glioma
    102879337 (AKT3)
   05221 Acute myeloid leukemia
    102879337 (AKT3)
   05220 Chronic myeloid leukemia
    102879337 (AKT3)
   05218 Melanoma
    102879337 (AKT3)
   05211 Renal cell carcinoma
    102879337 (AKT3)
   05215 Prostate cancer
    102879337 (AKT3)
   05213 Endometrial cancer
    102879337 (AKT3)
   05224 Breast cancer
    102879337 (AKT3)
   05222 Small cell lung cancer
    102879337 (AKT3)
   05223 Non-small cell lung cancer
    102879337 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102879337 (AKT3)
   05017 Spinocerebellar ataxia
    102879337 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102879337 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102879337 (AKT3)
   04931 Insulin resistance
    102879337 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102879337 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102879337 (AKT3)
   05135 Yersinia infection
    102879337 (AKT3)
   05152 Tuberculosis
    102879337 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102879337 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    102879337 (AKT3)
   05161 Hepatitis B
    102879337 (AKT3)
   05160 Hepatitis C
    102879337 (AKT3)
   05164 Influenza A
    102879337 (AKT3)
   05162 Measles
    102879337 (AKT3)
   05168 Herpes simplex virus 1 infection
    102879337 (AKT3)
   05163 Human cytomegalovirus infection
    102879337 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102879337 (AKT3)
   05169 Epstein-Barr virus infection
    102879337 (AKT3)
   05165 Human papillomavirus infection
    102879337 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102879337 (AKT3)
   05142 Chagas disease
    102879337 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102879337 (AKT3)
   01524 Platinum drug resistance
    102879337 (AKT3)
   01522 Endocrine resistance
    102879337 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102879337 (AKT3)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102879337 (AKT3)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102879337 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 102879337
NCBI-ProteinID: XP_006914322
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDSERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctattcaggctgtagcagacagacttcagaggcaagaagaggagagaatgaactgtagt
ccaacttcacagattgataacataggggaggaagagatggatgcttctacaactcatcat
aaaagaaagactatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtgggaaatattatgcaatgaagattctgaag
aaagaagttattattgcaaaggatgaagtggcacatactctaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgcgagag
cgggtgttctctgaggaccgcacacgcttctacggagcagagattgtctctgccttggac
tatctgcattccgggaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaattacggattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacgttctgtggtacaccagaatatctggcgccagaggtgttggaagat
aatgactatggccgggcagtggactggtggggccttggcgtcgtcatgtatgagatgatg
tgtgggagattgcctttctacaaccaggatcacgagaaactttttgaactaatactaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcgttgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttctctggagtaaactggcaagatgtatatgacaaaaagcttgtacct
ccttttaagcctcaagtaacatccgagacagataccagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatacgacgaggacggcatggactgcgtg
gacagcgagcggcggccgcacttcccccagttttcctactcggccagcggacgcgaatag

KEGG   Pteropus alecto (black flying fox): 102885144
Entry
102885144         CDS       T02993                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04210  Apoptosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04218  Cellular senescence
pale04261  Adrenergic signaling in cardiomyocytes
pale04370  VEGF signaling pathway
pale04371  Apelin signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04620  Toll-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04668  TNF signaling pathway
pale04722  Neurotrophin signaling pathway
pale04725  Cholinergic synapse
pale04728  Dopaminergic synapse
pale04910  Insulin signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04920  Adipocytokine signaling pathway
pale04922  Glucagon signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04926  Relaxin signaling pathway
pale04929  GnRH secretion
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale04973  Carbohydrate digestion and absorption
pale05010  Alzheimer disease
pale05017  Spinocerebellar ataxia
pale05132  Salmonella infection
pale05135  Yersinia infection
pale05142  Chagas disease
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102885144 (AKT1)
   04012 ErbB signaling pathway
    102885144 (AKT1)
   04014 Ras signaling pathway
    102885144 (AKT1)
   04015 Rap1 signaling pathway
    102885144 (AKT1)
   04370 VEGF signaling pathway
    102885144 (AKT1)
   04371 Apelin signaling pathway
    102885144 (AKT1)
   04630 JAK-STAT signaling pathway
    102885144 (AKT1)
   04668 TNF signaling pathway
    102885144 (AKT1)
   04066 HIF-1 signaling pathway
    102885144 (AKT1)
   04068 FoxO signaling pathway
    102885144 (AKT1)
   04072 Phospholipase D signaling pathway
    102885144 (AKT1)
   04071 Sphingolipid signaling pathway
    102885144 (AKT1)
   04024 cAMP signaling pathway
    102885144 (AKT1)
   04022 cGMP-PKG signaling pathway
    102885144 (AKT1)
   04151 PI3K-Akt signaling pathway
    102885144 (AKT1)
   04152 AMPK signaling pathway
    102885144 (AKT1)
   04150 mTOR signaling pathway
    102885144 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102885144 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    102885144 (AKT1)
   04218 Cellular senescence
    102885144 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102885144 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102885144 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102885144 (AKT1)
   04613 Neutrophil extracellular trap formation
    102885144 (AKT1)
   04620 Toll-like receptor signaling pathway
    102885144 (AKT1)
   04625 C-type lectin receptor signaling pathway
    102885144 (AKT1)
   04660 T cell receptor signaling pathway
    102885144 (AKT1)
   04662 B cell receptor signaling pathway
    102885144 (AKT1)
   04664 Fc epsilon RI signaling pathway
    102885144 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    102885144 (AKT1)
   04062 Chemokine signaling pathway
    102885144 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102885144 (AKT1)
   04922 Glucagon signaling pathway
    102885144 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    102885144 (AKT1)
   04920 Adipocytokine signaling pathway
    102885144 (AKT1)
   04929 GnRH secretion
    102885144 (AKT1)
   04915 Estrogen signaling pathway
    102885144 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    102885144 (AKT1)
   04917 Prolactin signaling pathway
    102885144 (AKT1)
   04926 Relaxin signaling pathway
    102885144 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    102885144 (AKT1)
   04919 Thyroid hormone signaling pathway
    102885144 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102885144 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102885144 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    102885144 (AKT1)
   04728 Dopaminergic synapse
    102885144 (AKT1)
   04722 Neurotrophin signaling pathway
    102885144 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102885144 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    102885144 (AKT1)
   04213 Longevity regulating pathway - multiple species
    102885144 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885144 (AKT1)
   05205 Proteoglycans in cancer
    102885144 (AKT1)
   05230 Central carbon metabolism in cancer
    102885144 (AKT1)
   05231 Choline metabolism in cancer
    102885144 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102885144 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102885144 (AKT1)
   05212 Pancreatic cancer
    102885144 (AKT1)
   05225 Hepatocellular carcinoma
    102885144 (AKT1)
   05226 Gastric cancer
    102885144 (AKT1)
   05214 Glioma
    102885144 (AKT1)
   05221 Acute myeloid leukemia
    102885144 (AKT1)
   05220 Chronic myeloid leukemia
    102885144 (AKT1)
   05218 Melanoma
    102885144 (AKT1)
   05211 Renal cell carcinoma
    102885144 (AKT1)
   05215 Prostate cancer
    102885144 (AKT1)
   05213 Endometrial cancer
    102885144 (AKT1)
   05224 Breast cancer
    102885144 (AKT1)
   05222 Small cell lung cancer
    102885144 (AKT1)
   05223 Non-small cell lung cancer
    102885144 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102885144 (AKT1)
   05017 Spinocerebellar ataxia
    102885144 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102885144 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102885144 (AKT1)
   04931 Insulin resistance
    102885144 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102885144 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102885144 (AKT1)
   05135 Yersinia infection
    102885144 (AKT1)
   05152 Tuberculosis
    102885144 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102885144 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    102885144 (AKT1)
   05161 Hepatitis B
    102885144 (AKT1)
   05160 Hepatitis C
    102885144 (AKT1)
   05164 Influenza A
    102885144 (AKT1)
   05162 Measles
    102885144 (AKT1)
   05168 Herpes simplex virus 1 infection
    102885144 (AKT1)
   05163 Human cytomegalovirus infection
    102885144 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102885144 (AKT1)
   05169 Epstein-Barr virus infection
    102885144 (AKT1)
   05165 Human papillomavirus infection
    102885144 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102885144 (AKT1)
   05142 Chagas disease
    102885144 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102885144 (AKT1)
   01524 Platinum drug resistance
    102885144 (AKT1)
   01522 Endocrine resistance
    102885144 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102885144 (AKT1)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102885144 (AKT1)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102885144 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102885144
NCBI-ProteinID: XP_006925670
UniProt: L5JSS5
LinkDB
Position
Unknown
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEHGESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDF
RSGSPSDNSGAEEMEVSVAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYSQDHEKLFEL
ILVGEIRFPRSLGPEARALLSGLLKKDPKQRLGGGPEDAKEIMQHRFFAGIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaggagggctggctgcacaaacgaggggagtacatcaag
acctggcggccccggtacttcctcctcaagaacgacggcaccttcatcggctacaaggag
cggccgcaggacgtggagcacggcgagtcgcccctcaacaacttctccgtggcacaatgc
cagctgatgaagacggagcggcctcggcccaacaccttcatcatccgctgcctgcagtgg
accacggtcatcgagcgcaccttccacgtggagacgcctgaggagcgggaggagtggaca
accgccatccagaccgtggccgacgggctcaagaggcaggaggaggagatgatggacttc
cgatcgggctcgcccagtgacaactcaggggctgaggagatggaggtgtcagtggccaag
cccaagcaccgcgtgaccatgaatgagttcgagtacctgaagctgctgggcaaaggcacc
ttcgggaaggtgatcctggtgaaggagaaggccacgggccgctactacgccatgaagatc
ctcaagaaggaggtcatcgtggccaaggacgaggtggcgcacacgctcacggagaaccgc
gtcctgcagaactcccggcaccccttcctgacggccttgaagtactccttccagacccac
gaccgcctctgcttcgtcatggagtacgccaacggcggcgagctgttcttccatctgtcg
cgggagcgggtgttccccgaggaccgggcccgcttctatggcgccgagatcgtgtcggcc
ctggactacctgcactcggagaagaacgtggtctaccgcgacctcaagctggagaacctc
atgctggacaaggacgggcacatcaagatcaccgacttcgggctgtgcaaggagggcatc
aaagacggcgccaccatgaagaccttctgcgggacccccgagtacctagcccccgaggtg
ctggaggacaatgactacggccgggcggtggactggtgggggctgggcgtggtcatgtac
gagatgctgtgcggccgcctgcccttctacagccaggaccacgagaagctcttcgagctc
atcctcgtgggggagatccgcttcccgcgctcgctcggccccgaggccagggccctgctc
tcggggctgctcaagaaggacccgaagcagaggctgggagggggccccgaggacgccaag
gagatcatgcagcaccgcttcttcgccggcatcgtgtggcaggacgtgtatgagaagaag
ctcagtccgcccttcaagccccaggtcacgtcagagacggataccaggtacttcgacgag
gagttcacggcgcagatgatcaccatcacgccaccggaccaagacgacaacatggagtgc
gtggacagcgagcggaggccccacttcccacagttctcctactcggccagcggcacggcc
tga

KEGG   Pteropus alecto (black flying fox): 102898305
Entry
102898305         CDS       T02993                                 

Gene name
AKT2
Definition
(RefSeq) LOW QUALITY PROTEIN: RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04210  Apoptosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04218  Cellular senescence
pale04261  Adrenergic signaling in cardiomyocytes
pale04370  VEGF signaling pathway
pale04371  Apelin signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04620  Toll-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04668  TNF signaling pathway
pale04722  Neurotrophin signaling pathway
pale04725  Cholinergic synapse
pale04728  Dopaminergic synapse
pale04910  Insulin signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04920  Adipocytokine signaling pathway
pale04922  Glucagon signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04926  Relaxin signaling pathway
pale04929  GnRH secretion
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale04973  Carbohydrate digestion and absorption
pale05010  Alzheimer disease
pale05017  Spinocerebellar ataxia
pale05132  Salmonella infection
pale05135  Yersinia infection
pale05142  Chagas disease
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102898305 (AKT2)
   04012 ErbB signaling pathway
    102898305 (AKT2)
   04014 Ras signaling pathway
    102898305 (AKT2)
   04015 Rap1 signaling pathway
    102898305 (AKT2)
   04370 VEGF signaling pathway
    102898305 (AKT2)
   04371 Apelin signaling pathway
    102898305 (AKT2)
   04630 JAK-STAT signaling pathway
    102898305 (AKT2)
   04668 TNF signaling pathway
    102898305 (AKT2)
   04066 HIF-1 signaling pathway
    102898305 (AKT2)
   04068 FoxO signaling pathway
    102898305 (AKT2)
   04072 Phospholipase D signaling pathway
    102898305 (AKT2)
   04071 Sphingolipid signaling pathway
    102898305 (AKT2)
   04024 cAMP signaling pathway
    102898305 (AKT2)
   04022 cGMP-PKG signaling pathway
    102898305 (AKT2)
   04151 PI3K-Akt signaling pathway
    102898305 (AKT2)
   04152 AMPK signaling pathway
    102898305 (AKT2)
   04150 mTOR signaling pathway
    102898305 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102898305 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    102898305 (AKT2)
   04218 Cellular senescence
    102898305 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102898305 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102898305 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102898305 (AKT2)
   04613 Neutrophil extracellular trap formation
    102898305 (AKT2)
   04620 Toll-like receptor signaling pathway
    102898305 (AKT2)
   04625 C-type lectin receptor signaling pathway
    102898305 (AKT2)
   04660 T cell receptor signaling pathway
    102898305 (AKT2)
   04662 B cell receptor signaling pathway
    102898305 (AKT2)
   04664 Fc epsilon RI signaling pathway
    102898305 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    102898305 (AKT2)
   04062 Chemokine signaling pathway
    102898305 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102898305 (AKT2)
   04922 Glucagon signaling pathway
    102898305 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    102898305 (AKT2)
   04920 Adipocytokine signaling pathway
    102898305 (AKT2)
   04929 GnRH secretion
    102898305 (AKT2)
   04915 Estrogen signaling pathway
    102898305 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    102898305 (AKT2)
   04917 Prolactin signaling pathway
    102898305 (AKT2)
   04926 Relaxin signaling pathway
    102898305 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    102898305 (AKT2)
   04919 Thyroid hormone signaling pathway
    102898305 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102898305 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102898305 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    102898305 (AKT2)
   04728 Dopaminergic synapse
    102898305 (AKT2)
   04722 Neurotrophin signaling pathway
    102898305 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102898305 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    102898305 (AKT2)
   04213 Longevity regulating pathway - multiple species
    102898305 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102898305 (AKT2)
   05205 Proteoglycans in cancer
    102898305 (AKT2)
   05230 Central carbon metabolism in cancer
    102898305 (AKT2)
   05231 Choline metabolism in cancer
    102898305 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102898305 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102898305 (AKT2)
   05212 Pancreatic cancer
    102898305 (AKT2)
   05225 Hepatocellular carcinoma
    102898305 (AKT2)
   05226 Gastric cancer
    102898305 (AKT2)
   05214 Glioma
    102898305 (AKT2)
   05221 Acute myeloid leukemia
    102898305 (AKT2)
   05220 Chronic myeloid leukemia
    102898305 (AKT2)
   05218 Melanoma
    102898305 (AKT2)
   05211 Renal cell carcinoma
    102898305 (AKT2)
   05215 Prostate cancer
    102898305 (AKT2)
   05213 Endometrial cancer
    102898305 (AKT2)
   05224 Breast cancer
    102898305 (AKT2)
   05222 Small cell lung cancer
    102898305 (AKT2)
   05223 Non-small cell lung cancer
    102898305 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102898305 (AKT2)
   05017 Spinocerebellar ataxia
    102898305 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102898305 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102898305 (AKT2)
   04931 Insulin resistance
    102898305 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102898305 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102898305 (AKT2)
   05135 Yersinia infection
    102898305 (AKT2)
   05152 Tuberculosis
    102898305 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102898305 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    102898305 (AKT2)
   05161 Hepatitis B
    102898305 (AKT2)
   05160 Hepatitis C
    102898305 (AKT2)
   05164 Influenza A
    102898305 (AKT2)
   05162 Measles
    102898305 (AKT2)
   05168 Herpes simplex virus 1 infection
    102898305 (AKT2)
   05163 Human cytomegalovirus infection
    102898305 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102898305 (AKT2)
   05169 Epstein-Barr virus infection
    102898305 (AKT2)
   05165 Human papillomavirus infection
    102898305 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102898305 (AKT2)
   05142 Chagas disease
    102898305 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102898305 (AKT2)
   01524 Platinum drug resistance
    102898305 (AKT2)
   01522 Endocrine resistance
    102898305 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102898305 (AKT2)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102898305 (AKT2)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102898305 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 102898305
NCBI-ProteinID: XP_006905466
LinkDB
Position
Unknown
AA seq 476 aa
MNEVSVIKEGWLHKRGEYIKTWRPRFFXSFIGYKERPEAPDQTLPPLNNFSVAECQLMKT
ERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMQAIQMVANSLKQRGPGEDPMDYKCG
SPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAMKILRK
EVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRER
VFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGA
TMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYNQDHERLFELILME
EIRFPRTLGPEAKALLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPP
FKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLDMDQRTHFPQFSYSASIRE
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggcttcacaagcgtggtgaatacatcaag
acctggaggccgcggttttttngctccttcattggctataaggaacgacccgaagccccc
gaccagacactgcccccgctaaacaacttctccgttgcagaatgtcagctgatgaagacg
gaaagaccacggcccaacacctttgtcatacgctgcctgcagtggaccacagtcatcgag
aggaccttccacgtggactctccagatgagagggaggaatggatgcaggccatccagatg
gtggccaacagcctcaagcagcggggcccgggtgaggaccccatggactacaagtgtggc
tcccctagtgactcttcagcggccgaggagatggaagtggcagttagcaaggcacgggcc
aaagtgaccatgaatgacttcgactatctcaagctccttggcaagggcacctttggcaaa
gtcattctggtgcgagagaaggccagcggccgctactacgccatgaagatcctgcggaag
gaggtcatcatcgccaaggatgaagtcgcccacaccgtcaccgagagccgagtcctccag
aataccagacacccattcctcactgcgctgaagtacgccttccagacccacgaccgcctg
tgctttgtgatggagtacgccaacggcggcgagctgttcttccacctgtcccgggagcgc
gtcttcacggaggagcgggcccgcttctacggcgcagagatcgtctcggccctggagtac
ctgcactcgcgggacgtggtttaccgtgacatcaagctggaaaacctcatgctggacaaa
gatggccacatcaagatcactgactttggtctgtgcaaagagggcatcagtgacggggcc
accatgaaaaccttctgcgggaccccggaatacctggcacctgaggtgctggaggacaac
gactatggccgggcagtggactggtgggggctaggcgtggtcatgtacgagatgctttgc
ggccgcctgcccttctacaaccaggaccacgagcgcctgttcgagctcatcctcatggag
gagatccgcttcccgcgcacgctcggccccgaggccaaggccctgcttgctgggctgctc
aagaaggacccaaagcagaggcttggcggggggcccagtgatgccaaggaggtgatggag
cacaggttcttcctcagcatcaactggcaggacgtggtacagaagaagctcctgccaccc
ttcaaacctcaggtcacgtctgaggttgacacaaggtacttcgatgacgagttcaccgcc
cagtccatcacaatcacacccccggaccgctatgacagcctgggctcgctcgacatggac
cagcggacccacttcccccagttctcctactcggccagcatccgcgagtga

DBGET integrated database retrieval system