KEGG   Pteropus alecto (black flying fox): 102879394
Entry
102879394         CDS       T02993                                 

Gene name
IL23A
Definition
(RefSeq) interleukin-23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04659  Th17 cell differentiation
pale05133  Pertussis
pale05152  Tuberculosis
pale05200  Pathways in cancer
pale05321  Inflammatory bowel disease
pale05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102879394 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102879394 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102879394 (IL23A)
   04659 Th17 cell differentiation
    102879394 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102879394 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102879394 (IL23A)
   05321 Inflammatory bowel disease
    102879394 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102879394 (IL23A)
   05152 Tuberculosis
    102879394 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102879394 (IL23A)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102879394 (IL23A)
SSDB
Motif
Pfam: IL23 IL6 GCSF
Other DBs
NCBI-GeneID: 102879394
NCBI-ProteinID: XP_006908966
UniProt: L5KWB6
LinkDB
Position
Unknown
AA seq 190 aa
MLGSRALMLLLLLAYPALGWAVPKSSSPAWAQCQQLSQKLCTLAWSAHPPMGHVDLPREE
GDDETTNDVPHIQCEDGCDPQGLRVNSQSCLQRIHQGLVFYERLLGSDIFTGEPSLLSSG
PVIQLHASLLGLRQLLQPEEHHWETEQTPSPSPSQPWQRLLLRLKILRSLQAFVAIAARV
FAHGAATLSP
NT seq 573 nt   +upstreamnt  +downstreamnt
atgctggggagtagagctctgatgctgctgctactgctggcctaccctgctctgggctgg
gctgtgcccaaaagcagcagccctgcctgggctcagtgccagcagctctcacagaagctc
tgcacactggcctggagtgcacatccaccaatgggacatgtggatctaccaagagaagag
ggagatgacgagactacaaatgatgtcccccatatccagtgtgaggatggttgtgatcct
caaggtctcagggtcaacagtcagtcctgcttgcaaaggatccaccagggcctggtgttt
tacgagaggctgctaggctcagacattttcacaggagagccttctttgctctccagtggc
cctgtgatccagcttcacgcctcccttttgggtctcaggcaactcttgcagcctgaggag
caccactgggagactgagcagactccaagccccagtcctagccaaccatggcagcgcctc
cttctccgcctcaagattcttcgcagcctccaggcctttgtggctatagctgccagggtc
tttgcccatggagcagcaaccctgagcccctaa

KEGG   Pteropus alecto (black flying fox): 102880610
Entry
102880610         CDS       T02993                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon omega-1-like
  KO
K05440  interferon omega
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04622  RIG-I-like receptor signaling pathway
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102880610
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102880610
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102880610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102880610
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interferons
   102880610
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102880610
NCBI-ProteinID: XP_015449918
LinkDB
Position
Unknown
AA seq 183 aa
PLLSLLMALLVISYSPGGSLGCNLSPDHIQVNKENIALMHQMQRISSFRCRKNRKDFRFP
RRXMMDGSQVQKAQAISVLHKMFQETSNIFCTEHSAVWNMTLLHGLLSGLHWQLEDLGTC
LVPQMKEAESALGTEDPKLSMKRYIQGICLYLEEKQYSNCAWEIVRVEIRRAFSLSTKLL
ERL
NT seq 552 nt   +upstreamnt  +downstreamnt
cccctgctctctctactcatggccctgctggtgattagctatagccccggtgggtctctg
ggctgtaacctgtctccggaccacatccaagtcaacaaggagaacattgcacttatgcac
caaatgcagagaatcagctcttttcgttgtaggaaaaacagaaaggactttagattcccc
aggagatagatgatggatggcagccaggtccaaaaggcccaggccatctctgtcctccac
aagatgttccaggagacctccaacatcttctgcacagagcactctgctgtctggaacatg
accctactgcacgggctcctcagtggactccattggcagctggaagacctgggcacctgt
ttagtgccgcagatgaaagaggcagaatctgccctgggaacagaggaccctaaattgtcc
atgaagaggtacatccagggcatctgtctctacctcgaagagaagcaatacagtaactgt
gcctgggagattgtcagagtggaaatcaggagagccttctctttatcaacaaagttgcta
gaaaggttataa

KEGG   Pteropus alecto (black flying fox): 102882436
Entry
102882436         CDS       T02993                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma precursor
  KO
K04687  interferon gamma
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale03050  Proteasome
pale04060  Cytokine-cytokine receptor interaction
pale04066  HIF-1 signaling pathway
pale04217  Necroptosis
pale04350  TGF-beta signaling pathway
pale04380  Osteoclast differentiation
pale04612  Antigen processing and presentation
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04940  Type I diabetes mellitus
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05143  African trypanosomiasis
pale05144  Malaria
pale05145  Toxoplasmosis
pale05146  Amoebiasis
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05164  Influenza A
pale05168  Herpes simplex virus 1 infection
pale05200  Pathways in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05321  Inflammatory bowel disease
pale05322  Systemic lupus erythematosus
pale05323  Rheumatoid arthritis
pale05330  Allograft rejection
pale05332  Graft-versus-host disease
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    102882436 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102882436 (IFNG)
   04630 JAK-STAT signaling pathway
    102882436 (IFNG)
   04066 HIF-1 signaling pathway
    102882436 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102882436 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102882436 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102882436 (IFNG)
   04612 Antigen processing and presentation
    102882436 (IFNG)
   04660 T cell receptor signaling pathway
    102882436 (IFNG)
   04658 Th1 and Th2 cell differentiation
    102882436 (IFNG)
   04659 Th17 cell differentiation
    102882436 (IFNG)
   04657 IL-17 signaling pathway
    102882436 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102882436 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102882436 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102882436 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102882436 (IFNG)
   05323 Rheumatoid arthritis
    102882436 (IFNG)
   05321 Inflammatory bowel disease
    102882436 (IFNG)
   05330 Allograft rejection
    102882436 (IFNG)
   05332 Graft-versus-host disease
    102882436 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102882436 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102882436 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102882436 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102882436 (IFNG)
   05164 Influenza A
    102882436 (IFNG)
   05168 Herpes simplex virus 1 infection
    102882436 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102882436 (IFNG)
   05144 Malaria
    102882436 (IFNG)
   05145 Toxoplasmosis
    102882436 (IFNG)
   05140 Leishmaniasis
    102882436 (IFNG)
   05142 Chagas disease
    102882436 (IFNG)
   05143 African trypanosomiasis
    102882436 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:pale03051]
    102882436 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102882436 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102882436 (IFNG)
Proteasome [BR:pale03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    102882436 (IFNG)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interferons
   102882436 (IFNG)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Cytokines
   102882436 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5 UQ_con PAZ_siRNAbind
Other DBs
NCBI-GeneID: 102882436
NCBI-ProteinID: NP_001277095
UniProt: H9MZI1
LinkDB
AA seq 165 aa
MMNYTSYILAFQLCVILGSSSCYCQATFLKEIENLKEYFNASNSNVADGGNLFLDILKNW
REESDKKIIQSQIVSFYFKLFENLKDNPIIQSSVQIIKEDLRVKFFNSNNSKLEDFKKVI
QIPVNNQTVQRKAISELFKVMTDLSPKSNQRKRKRSQSLFRGWKA
NT seq 498 nt   +upstreamnt  +downstreamnt
atgatgaattatacaagttatatcttagcttttcagctttgcgtgattttgggttcttct
agctgctactgccaggctacatttttaaaagaaatagaaaacctaaaggaatattttaat
gcaagtaattcaaatgtagcagatggtgggaatcttttcctagatattttgaagaattgg
agagaggagagtgacaaaaaaataattcagagccaaattgtttccttctacttcaaactc
ttcgaaaacttaaaagataacccaatcattcaaagcagtgtgcagatcatcaaggaggac
ctgcgtgttaagttcttcaacagcaacaacagcaaactggaagacttcaagaaagtgatt
caaatcccggtaaataatcagacggtccagcgcaaagcaataagtgaactctttaaagtg
atgactgatctgtcaccaaaatctaaccaaaggaagaggaaaaggagtcagagtctgttt
cgtggttggaaagcatag

KEGG   Pteropus alecto (black flying fox): 102882571
Entry
102882571         CDS       T02993                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04622  RIG-I-like receptor signaling pathway
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102882571
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102882571
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102882571
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102882571
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interferons
   102882571
SSDB
Motif
Pfam: Interferon Syntaxin-6_N
Other DBs
NCBI-GeneID: 102882571
NCBI-ProteinID: XP_006917251
UniProt: L5KBH2
LinkDB
Position
Unknown
AA seq 185 aa
MAPVLPLLTALLVFGYGPVGSLGCDLSQDHVQVSKENIALLHQMQRISSFRCRKDRKNFG
FLREMVDGSHMQKAQAISVLQEMLQEISNVFGTQQSSGAWNTTLLHGLLSGLHWQLEDLG
TCLVPEMKEAESALGMEDPALAVKKYFQGIRLYLKEKEYSVCAWEVVRVEIRKAFSLSTN
LLDRL
NT seq 558 nt   +upstreamnt  +downstreamnt
atggcccctgtgctacctctactcacggccctgctggtgttcggctatggtcctgttggg
tctctgggctgcgacctctctcaagaccacgtccaggtcagcaaggagaacatcgcactt
ctgcatcaaatgcagagaatcagctctttccgctgtcgaaaggacagaaagaacttcgga
ttcctacgggaaatggtggatggcagccacatgcagaaggcccaggccatctctgtcctc
caggagatgctccaggagatctccaacgtctttggtacacagcagtcctctggtgcctgg
aacacgaccctgctgcacgggctactcagtggactccattggcagctggaagacctgggt
acctgtttggtgccagagatgaaagaggcggaatctgccctgggaatggaggaccctgca
ctggccgtgaagaagtacttccagggcatccgtctctatctcaaagagaaggaatacagt
gtctgtgcctgggaggttgtcagagtggaaatcaggaaagccttctctttatcaacaaac
ttgctagacaggttatga

KEGG   Pteropus alecto (black flying fox): 102882933
Entry
102882933         CDS       T02993                                 

Gene name
IL22
Definition
(RefSeq) interleukin-22
  KO
K05445  interleukin 22
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04659  Th17 cell differentiation
pale05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102882933 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102882933 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102882933 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    102882933 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102882933 (IL22)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102882933 (IL22)
SSDB
Motif
Pfam: IL22 IL10 IL28A
Other DBs
NCBI-GeneID: 102882933
NCBI-ProteinID: XP_006923779
UniProt: L5JVH5
LinkDB
Position
Unknown
AA seq 179 aa
MATPRKSVSFSLMRTLATGCLLLIALSVQEGAAVPIGSLCRLDKSNFQQPYITNHTFMLA
KEARSADNNTDVRLIGEKLFRGVHMSERCYLMKQVLNFTLEEVLLPQSDRFQPYMQEVVP
FLARLSNKLSQCHIKSDDQHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMTLRNVCI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggccaccccgcggaaatctgtgagcttttcccttatgaggactctggccactggctgc
cttcttctcattgccctgtcggtgcaggaaggagcagctgtgcccattgggtctctctgc
agacttgacaagtccaacttccagcagccctacatcaccaaccacactttcatgctggct
aaagaggctaggtcggcagacaacaatacagatgttcgtctcattggggagaaactgttc
cgtggagtccatatgagtgagcgctgctatctgatgaagcaggtgctgaactttaccctt
gaagaagtgttgctcccccagtctgatagattccagccctacatgcaggaagtagtgcct
ttcctggccaggctcagcaacaagctaagccaatgtcatattaagagtgatgatcagcat
atccaaagaaacgtgcaaaagctgaaggacacagtgaaaaagcttggagagagtggagaa
atcaaagcaattggagaactagacttgctgtttatgaccctgagaaatgtctgcatttga

KEGG   Pteropus alecto (black flying fox): 102884214
Entry
102884214         CDS       T02993                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04620  Toll-like receptor signaling pathway
pale04622  RIG-I-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04940  Type I diabetes mellitus
pale05133  Pertussis
pale05134  Legionellosis
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05143  African trypanosomiasis
pale05145  Toxoplasmosis
pale05146  Amoebiasis
pale05152  Tuberculosis
pale05162  Measles
pale05164  Influenza A
pale05168  Herpes simplex virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05321  Inflammatory bowel disease
pale05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102884214 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102884214 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102884214 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    102884214 (IL12B)
   04625 C-type lectin receptor signaling pathway
    102884214 (IL12B)
   04658 Th1 and Th2 cell differentiation
    102884214 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102884214 (IL12B)
   05205 Proteoglycans in cancer
    102884214 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102884214 (IL12B)
   05330 Allograft rejection
    102884214 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102884214 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102884214 (IL12B)
   05134 Legionellosis
    102884214 (IL12B)
   05152 Tuberculosis
    102884214 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102884214 (IL12B)
   05164 Influenza A
    102884214 (IL12B)
   05162 Measles
    102884214 (IL12B)
   05168 Herpes simplex virus 1 infection
    102884214 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102884214 (IL12B)
   05145 Toxoplasmosis
    102884214 (IL12B)
   05140 Leishmaniasis
    102884214 (IL12B)
   05142 Chagas disease
    102884214 (IL12B)
   05143 African trypanosomiasis
    102884214 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102884214 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102884214 (IL12B)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102884214 (IL12B)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Cytokines
   102884214 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_3 Ig_4 fn3 Ig_2 I-set Tissue_fac
Other DBs
NCBI-GeneID: 102884214
NCBI-ProteinID: XP_006906535
UniProt: L5L233
LinkDB
Position
Unknown
AA seq 329 aa
MLQQQLVLSCFSLVLLASPLLAIWELEKDVYVVELDWYPDAPGEMVVLTCDTPEEEGITW
TSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKEGKILSQSLLLLHKKEDGIWSTDILKDQ
KEPKNKTFLKCKAKNYSGHFTCWWLTAISADLKFSVKSSRGSSDPRGVTCGAATLSAERV
RVDNREYKKYTVACQEGNSCPAAEESLPIEVLVDAVHKLKYENYTSSFFIRDIIKPDPPK
NLQLKPLKNSRHVEVSWEYPDTWSTPHSYFSLTFSLQVQGKNKREKKDRLFVDQTSAKVT
CHKDAMIRVQARDRYYSSSWSEWASVSCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcttcagcagcagttggtcctctcctgtttttccctggttttactggcatcacccctt
ctggccatatgggaactggagaaagatgtttatgttgtagagttggattggtaccctgat
gcccctggagaaatggtggtcctcacctgcgatacccctgaagaagaaggcatcacctgg
acctcagaccagagcagtgaggtcttaggctctggcaaaaccttgaccatccaagtcaaa
gaattcggagatgctggccagtacacctgtcacaaagagggcaagattctgagccagtct
ctcctgctgcttcacaaaaaggaagatggcatttggtccactgatattttaaaggaccag
aaagaacccaaaaataagacctttctaaaatgtaaagcaaagaattattctggacatttc
acctgctggtggctgactgcaatcagtgctgatttgaaattcagtgtcaaaagcagcaga
ggctcctctgacccccgaggggtgacgtgtggagcagcgacactctcagcagagagggtc
agagtggacaacagggagtataagaagtacacagtggcgtgtcaagagggcaattcgtgc
cccgccgctgaggagagcctgcccattgaggtcttggtggatgctgttcacaagctcaag
tatgaaaactacactagcagcttcttcatcagggacatcatcaaaccagacccacccaag
aacctgcagctaaagccattaaagaattcccggcatgtggaggtcagctgggagtacccc
gacacctggagcaccccacattcctacttctccctgacattttctcttcaggtccagggc
aagaacaagagagaaaagaaagatagactcttcgtggatcagacctcagccaaggtaacg
tgccacaaggatgccatgatccgcgtgcaagctcgggaccgctactatagctcatcctgg
agtgaatgggcatcagtgtcctgcagttag

KEGG   Pteropus alecto (black flying fox): 102886533
Entry
102886533         CDS       T02993                                 

Gene name
IL24
Definition
(RefSeq) interleukin-24
  KO
K22668  interleukin 24
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102886533 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102886533 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102886533 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102886533 (IL24)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102886533 (IL24)
SSDB
Motif
Pfam: IL22 IL10
Other DBs
NCBI-GeneID: 102886533
NCBI-ProteinID: XP_006922884
LinkDB
Position
Unknown
AA seq 183 aa
MGSPMQKAALPCLSFILLVWSWAPGVQGQEFQFGSCRVKGVDFQELWEAFQAMKDIVQAQ
DNITSIRLLRREVLQNVSDTESCYLIRALLKFYLNTVFKSYHEKAAEFRILKSFSTLANN
FIFIASKLQPSVSRTKLGPGESARRRFLLFQRAFKQLDIEAAQTKAFGEVDILLTWMQKF
YQL
NT seq 552 nt   +upstreamnt  +downstreamnt
atgggctctccaatgcagaaggctgccctcccctgcctgagtttcatcctgcttgtctgg
agctgggcaccaggggtccaaggccaagaattccaattcgggtcctgccgagtgaaggga
gtagatttccaggaactatgggaggccttccaagccatgaaggacattgtgcaagctcag
gataacatcacaagcatccggctactgcggagggaggttctgcagaatgtctcggacact
gaaagctgttacctgatccgtgccctgctgaagttctacttgaataccgttttcaagagc
taccacgagaaggcagctgaattccggatcctgaagtcattctccactctggccaacaat
tttattttcatcgcatcaaaactgcaacccagcgtgagtagaacaaagctgggcccagga
gagagtgcacgcaggcggtttctgctcttccagagggcatttaaacagttggacatagaa
gcagctcagaccaaagcctttggagaagtggacattctcttgacctggatgcagaaattc
taccagctctga

KEGG   Pteropus alecto (black flying fox): 102886783
Entry
102886783         CDS       T02993                                 

Gene name
IL20
Definition
(RefSeq) interleukin-20
  KO
K22667  interleukin 20
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102886783 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102886783 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102886783 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102886783 (IL20)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102886783 (IL20)
SSDB
Motif
Pfam: IL10 DUF1922
Other DBs
NCBI-GeneID: 102886783
NCBI-ProteinID: XP_006922885
UniProt: L5JXR2
LinkDB
Position
Unknown
AA seq 176 aa
MKGSGLPLCILVAVFYLSWTPSAGLKILHLGSCVVTTNLQEMHNGFSEIRDTVQAKDKII
DIRILRKTESLQDTKPADQCCLLRHILRLYLNTVFKNYQTPDHHILRKISSLANSFLTIK
KDLRLCHAHMTCPCGEEAKEKYSQILSHFEELEPQEAVVKALGELDILLRWMEETE
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaaggctctggtctccccctctgcattctcgtggctgtgttttatctctcctggaca
ccttctgctgggctgaagatactccatttgggaagctgtgtggtcaccactaaccttcag
gaaatgcacaatggattttctgagatacgggacactgtgcaagccaaagataaaatcatt
gacatcagaatcttgaggaagaccgagtctttgcaagacacaaagcctgcagatcagtgc
tgcctcctccgccatatactgagactctacctgaacacagtattcaaaaactatcagacc
cctgaccaccatatcctccggaagatcagcagccttgccaactcttttcttactatcaag
aaggacctccgactttgtcatgcccatatgacatgcccttgtggagaggaagcaaaggag
aaatacagccaaattctgagtcacttcgaagagctcgagcctcaggaagcggtggtgaaa
gctttgggagagctagacattctcctgcgatggatggaggagacagaataa

KEGG   Pteropus alecto (black flying fox): 102887033
Entry
102887033         CDS       T02993                                 

Gene name
IL19
Definition
(RefSeq) interleukin-19
  KO
K05444  interleukin 19
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102887033 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102887033 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102887033 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102887033 (IL19)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102887033 (IL19)
SSDB
Motif
Pfam: IL10
Other DBs
NCBI-GeneID: 102887033
NCBI-ProteinID: XP_006922886
LinkDB
Position
Unknown
AA seq 177 aa
MKAQRVSLWFLGTMFFLCSVHTRGLRRCLISMDMHHIEESFREIKGAIQAKDIFQNVTIL
STLEILRSVKPLDVCCMTTNLLAFYVDRVFKDHQELNPQILRKISSIANSFLYMQKALQQ
CQEQRLCHCGQEATNATRIIHNNYNQLEVQSAALKSLGELDVFLAWVHKNHQGASTA
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaaggcacagcgtgtttccctctggttcctgggcacaatgttcttcttgtgctcagtg
cacacccgaggtctcaggagatgtctgatttccatggacatgcaccatatagaagagagt
ttccgagaaatcaaaggagccatccaagctaaggacatcttccaaaatgttaccatcctg
tctacattggagatcctgcgcagcgttaagcccttagatgtgtgctgcatgaccacgaac
cttctggcattttacgtggacagggtattcaaggaccatcaggagctgaacccccaaatc
ttgagaaaaatcagcagcattgccaactctttcctctacatgcagaaggctctgcagcaa
tgtcaggaacagagactgtgtcattgcgggcaggaagccaccaatgcaaccagaatcatc
cacaacaactataatcagctggaagtccagtctgccgccctcaagtctctgggagagctg
gatgtctttctggcctgggttcacaagaatcatcaaggagcttccactgcctga

KEGG   Pteropus alecto (black flying fox): 102887289
Entry
102887289         CDS       T02993                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04068  FoxO signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04660  T cell receptor signaling pathway
pale04672  Intestinal immune network for IgA production
pale05133  Pertussis
pale05135  Yersinia infection
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05143  African trypanosomiasis
pale05144  Malaria
pale05145  Toxoplasmosis
pale05146  Amoebiasis
pale05150  Staphylococcus aureus infection
pale05152  Tuberculosis
pale05310  Asthma
pale05320  Autoimmune thyroid disease
pale05321  Inflammatory bowel disease
pale05322  Systemic lupus erythematosus
pale05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102887289 (IL10)
   04068 FoxO signaling pathway
    102887289 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102887289 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102887289 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102887289 (IL10)
   04660 T cell receptor signaling pathway
    102887289 (IL10)
   04672 Intestinal immune network for IgA production
    102887289 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102887289 (IL10)
   05322 Systemic lupus erythematosus
    102887289 (IL10)
   05320 Autoimmune thyroid disease
    102887289 (IL10)
   05321 Inflammatory bowel disease
    102887289 (IL10)
   05330 Allograft rejection
    102887289 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102887289 (IL10)
   05133 Pertussis
    102887289 (IL10)
   05150 Staphylococcus aureus infection
    102887289 (IL10)
   05152 Tuberculosis
    102887289 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102887289 (IL10)
   05144 Malaria
    102887289 (IL10)
   05145 Toxoplasmosis
    102887289 (IL10)
   05140 Leishmaniasis
    102887289 (IL10)
   05142 Chagas disease
    102887289 (IL10)
   05143 African trypanosomiasis
    102887289 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102887289 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102887289 (IL10)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102887289 (IL10)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Cytokines
   102887289 (IL10)
SSDB
Motif
Pfam: IL10 IL22 CLZ
Other DBs
NCBI-GeneID: 102887289
NCBI-ProteinID: XP_006922887
UniProt: L5JYH4
LinkDB
Position
Unknown
AA seq 178 aa
MPSSALLCCLVFLAGVGASRDQRTPSENSCTHFPASLPSMLHELRAAFDKVKAFFQMKDQ
LDNILLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAESQGPDIKKHVNSLGEKLKTLR
LRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKMKK
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcccagctcagcactgctctgttgcctggtcttcctggccggggtgggggccagccga
gaccagcgcaccccgtctgagaacagctgcacccacttcccagccagcctgcccagcatg
cttcacgagctccgagctgcctttgacaaggtgaaggctttctttcaaatgaaggaccag
ctggacaacatattgctgaacgggtccttgctggaggactttaagggttacctgggttgc
caagccttgtcggagatgatccaattttacctggaggaggtgatgccccaggctgagagc
cagggcccagacatcaagaaacacgtgaactcccttggggaaaagctgaagacactcagg
ctgaggcttcggcgctgccatcgctttctaccctgtgagaataagagcaaagcagtggag
caggtgaagagcgcttttagtaagctccaagagaaaggggtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctacatgacaatgaagatgaaaaagtaa

KEGG   Pteropus alecto (black flying fox): 102887342
Entry
102887342         CDS       T02993                                 

Gene name
IL11
Definition
(RefSeq) interleukin-11 isoform X2
  KO
K05417  interleukin 11
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102887342 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102887342 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102887342 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    102887342 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102887342 (IL11)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102887342 (IL11)
SSDB
Motif
Pfam: IL11
Other DBs
NCBI-GeneID: 102887342
NCBI-ProteinID: XP_006916009
LinkDB
Position
Unknown
AA seq 199 aa
MNSVCCLVLVALSLWPDRAAAPGPPPGPPRASADPRAELDSAVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLFSYLRHVQWLRRAGGPSLR
TLEPELGALQARLDRLLRRLQLLMSRLALPQAPPDPPAPPLAPPASAWGGIRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaacagtgtttgctgcctggtcctggtcgcgctgagcctgtggccagatagagctgct
gccccagggccacctcctggccccccaagggcctccgcagaccctcgggctgagctggac
agcgccgttctcctgacgcgctctctcctggcggacactcggcaactggccgcacagctg
agagacaaatttccagccgacggagaccacaacttggattccctccccaccttggccatg
agtgcgggggctctgggagccttgcagctccccggtgtgctgacacggctgcgggcagac
ttgttttcctacctgaggcatgtgcaatggctgcgccgggcaggaggcccttccctgcgg
accctggagcctgagctgggggccctgcaggccaggttggaccggctgctgcgccggctg
cagctcctgatgtcccgtctggcgctgccccaggcgcccccagacccgccagcacccccc
ctggccccgccggcctcagcctggggaggcatccgggcagcccacgccattctcgggggg
ctgcacctgacgctggactgggccgtgaggggtttgctgctgctcaagactcggctgtga

KEGG   Pteropus alecto (black flying fox): 102887558
Entry
102887558         CDS       T02993                                 

Gene name
IL15
Definition
(RefSeq) interleukin-15 isoform X2
  KO
K05433  interleukin 15
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04668  TNF signaling pathway
pale04672  Intestinal immune network for IgA production
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102887558 (IL15)
   04668 TNF signaling pathway
    102887558 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102887558 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102887558 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102887558 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102887558 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102887558 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102887558 (IL15)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102887558 (IL15)
SSDB
Motif
Pfam: IL15 AAA_lid_7
Other DBs
NCBI-GeneID: 102887558
NCBI-ProteinID: XP_006906293
LinkDB
Position
Unknown
AA seq 162 aa
MRISKPYLRSTSIQCYLCLLLNSHFLTEAGIHVFILGRVSAGLPKTESNWQYVIRDLQKF
ENLIQSIHIDATLYTESSVHPSCKVTAMKCFLLEFHVIWQESNNMDVRETIENLIILANK
SLSSNGNVTESGCKECEELEEKNVKEFLRSFNHIVQMFINTS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaatttcgaaaccatatttgagaagtacgtccatccagtgctatttgtgtttactc
ctgaacagtcactttttaaccgaggccggcattcatgtcttcattttgggccgtgtcagt
gcaggtcttcctaaaacagagtcaaactggcagtatgtaataagagatttgcaaaaattt
gaaaatcttattcaatctatacatattgatgctactttatatacggaaagttctgttcat
cccagttgcaaagtaacggcgatgaagtgctttcttctggaattccatgttatttggcag
gagtcgaataatatggacgttagagagacaatagaaaaccttatcatcctagcaaacaaa
agtttatcttctaatggaaacgtaacggaatctggatgcaaagaatgcgaggagctggag
gaaaaaaatgttaaagaatttttgcggagttttaaccatattgtgcaaatgttcatcaac
acttcttga

KEGG   Pteropus alecto (black flying fox): 102887571
Entry
102887571         CDS       T02993                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04620  Toll-like receptor signaling pathway
pale04622  RIG-I-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04940  Type I diabetes mellitus
pale05133  Pertussis
pale05134  Legionellosis
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05143  African trypanosomiasis
pale05144  Malaria
pale05145  Toxoplasmosis
pale05146  Amoebiasis
pale05152  Tuberculosis
pale05162  Measles
pale05164  Influenza A
pale05168  Herpes simplex virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05321  Inflammatory bowel disease
pale05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102887571 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102887571 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102887571 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    102887571 (IL12A)
   04625 C-type lectin receptor signaling pathway
    102887571 (IL12A)
   04658 Th1 and Th2 cell differentiation
    102887571 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102887571 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102887571 (IL12A)
   05330 Allograft rejection
    102887571 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102887571 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102887571 (IL12A)
   05134 Legionellosis
    102887571 (IL12A)
   05152 Tuberculosis
    102887571 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102887571 (IL12A)
   05164 Influenza A
    102887571 (IL12A)
   05162 Measles
    102887571 (IL12A)
   05168 Herpes simplex virus 1 infection
    102887571 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102887571 (IL12A)
   05144 Malaria
    102887571 (IL12A)
   05145 Toxoplasmosis
    102887571 (IL12A)
   05140 Leishmaniasis
    102887571 (IL12A)
   05142 Chagas disease
    102887571 (IL12A)
   05143 African trypanosomiasis
    102887571 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102887571 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102887571 (IL12A)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102887571 (IL12A)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Cytokines
   102887571 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 102887571
NCBI-ProteinID: XP_006908250
LinkDB
Position
Unknown
AA seq 222 aa
MNPPHGLLLVATLVLLNHLDHFSLARNLPTATPGPGMFKCLNHSQNLLRAVSSALQKARQ
TLEFYSCTSEEIDHEDITKDKTSTIEACLPLELTTNESCLVSREISFITNGNCLASGKAS
YMMTLCLSSIYEDLKMYQVEFKAMNAKLLMDPKRQIILDQNMLAAIDELMQALNFNSEIV
PQKPFFEEPDLYKTKIKLCILLHAFRIRAVTIDRMMSYLNSS
NT seq 669 nt   +upstreamnt  +downstreamnt
atgaacccaccgcacggactcctccttgtggccactctggtcctcctaaaccacctggac
cacttcagtttggccaggaacctccccacagccacaccaggcccaggaatgttcaagtgc
ctcaaccattcccaaaacctgctgagggccgtcagcagcgcacttcagaaggccagacaa
actctagaattttactcctgcacttctgaagagattgatcatgaagatattacaaaagat
aaaaccagcaccatagaggcctgtttgccactggaattaaccacgaatgaaagttgcctg
gtttccagagagatctctttcataactaatgggaattgcctggcctctgggaaggcttct
tatatgatgaccctctgccttagtagtatctatgaggacttgaagatgtaccaggtggag
ttcaaggccatgaatgcaaagcttttgatggatcctaagaggcagatcattctggatcaa
aatatgctggcagctattgatgagctaatgcaggccctgaatttcaacagtgagattgtg
ccacaaaaacccttctttgaagaaccagatttatataagactaaaatcaagctctgcatc
cttcttcatgctttcagaattcgtgcagtgactattgataggatgatgagctatctgaat
tcttcctaa

KEGG   Pteropus alecto (black flying fox): 102889191
Entry
102889191         CDS       T02993                                 

Gene name
LIF
Definition
(RefSeq) leukemia inhibitory factor isoform X1
  KO
K05419  leukemia inhibitory factor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04630  JAK-STAT signaling pathway
pale04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102889191 (LIF)
   04668 TNF signaling pathway
    102889191 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102889191 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102889191 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102889191 (LIF)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102889191 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 102889191
NCBI-ProteinID: XP_006904965
LinkDB
Position
Unknown
AA seq 263 aa
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCVTRHPCHNNLMNQIRNQLAQLNSSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKARLVELYRIIAYLGASLGNIT
RDQKILNPNALSLHSKLNATTDTMRGLLSNVLCRLCSKYHVAHVEVAYGPDTSGLTKGAY
ETEMHESVLAGSSTGGDGENRMNLRHRSPLYQGKGVLSPSGCRRKSPRPGGAGRLVEKGT
SGINKLPADCSPDCSGVPGLDKT
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaaggtcttggcagcaggagtcgtccccctgctgctggttctgcactggaaacacggg
gcagggagcccccttcccatcacccccgtcaacgccacctgtgtcacacgccacccatgt
cacaacaacctcatgaaccagatcaggaaccaactggcccagctcaacagcagtgccaat
gccctcttcattctctattacacggcccaaggggagccattccccaacaacctggacaag
ctgtgtggccccaacgtgacagacttcccacccttccatgccaatggcacggaaaaggcc
cggctggtggagctgtaccgcatcatcgcgtaccttggcgcctccctgggcaacatcaca
cgggaccagaagatcctcaatcccaacgccctcagcctccacagcaagctgaatgccacc
acagacaccatgcggggcctcctcagtaacgtgctatgccgcctgtgcagcaagtaccat
gtggcccacgtggaggtggcctatggccctgacacctcagggttgacaaagggagcctat
gagacagaaatgcatgaatcggtactggccggctcatccacaggtggagatggagaaaac
agaatgaatctcagacaccggagtcctctctaccagggaaaaggggtcctctcccccagc
ggatgcagaagaaagagtccaaggccaggcggtgcgggcaggctggtggagaaggggaca
agcgggataaacaaactaccagctgattgctcccctgactgttccggagtcccgggcctg
gacaagacctga

KEGG   Pteropus alecto (black flying fox): 102889242
Entry
102889242         CDS       T02993                                 

Gene name
CTF1
Definition
(RefSeq) cardiotrophin-1
  KO
K05422  cardiotrophin 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102889242 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102889242 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102889242 (CTF1)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102889242 (CTF1)
SSDB
Other DBs
NCBI-GeneID: 102889242
NCBI-ProteinID: XP_024904189
LinkDB
Position
Unknown
AA seq 120 aa
MSQREGSLEDPQADSSISPLPHLEAKIHQTHSLARLLTKYAEQLLQEYVQHQGDPFGLPG
FSPPWLPVAGLSAPAPGHAASTAAGVFPAKVLGLRVCGLYREWVSRTEADLSQLVPGGPA
NT seq 363 nt   +upstreamnt  +downstreamnt
atgagccagagggagggaagtctggaagacccccaagctgactcctcaatctcacccctt
cctcacttggaggccaagatccatcagacacacagccttgcccgcctcctcacaaaatat
gctgagcagctgctccaggaatatgtgcagcaccaaggagaccccttcgggctccccggc
ttctcgcctccatggctgccggtggcaggcctgagcgccccggccccgggccatgcggcc
tcgaccgccgcgggcgtcttcccagccaaggtgctggggctccgcgtgtgcggcctctac
cgcgagtgggtgagccgcacagaggcagacctgagccagctggtgcctgggggcccggcc
tga

KEGG   Pteropus alecto (black flying fox): 102889450
Entry
102889450         CDS       T02993                                 

Gene name
OSM
Definition
(RefSeq) oncostatin-M
  KO
K05418  oncostatin M
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102889450 (OSM)
   04151 PI3K-Akt signaling pathway
    102889450 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102889450 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102889450 (OSM)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102889450 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 102889450
NCBI-ProteinID: XP_006904966
LinkDB
Position
Unknown
AA seq 235 aa
MRARLTRRALLSLVLRLLFLNPVATGSCSGDDQELLKQLQHQADFLQDTSTLLDPYIRSQ
GLDVSGLKERCQERPGVFPSEDALQALSRRGFLQTLNAKLSHVLQRLTAFQEDLPEVQAL
VKVKMYIFGVKNNIHCLAQLLPDSAKTAEPTQAGPGASRPPTTTPDTFQRKIEGCEFLRG
YHRFMHSVGQVFYKWRKGPSRSPRHSSHQALQRGAHGMQPFTRGKGLLPRGQLPR
NT seq 708 nt   +upstreamnt  +downstreamnt
atgcgggcacggcttactaggagggcgctgctcagtctggtcctcagactcctgttcctg
aacccagtggccacgggcagctgctcgggcgatgaccaagagctcctcaaacagctccag
catcaggcggacttcttgcaggacaccagcacgctcctggacccctatatccgcagccaa
ggcttggacgtgtctggactgaaggagcgctgccaagagcgccctggagtctttcccagt
gaggatgccctgcaggcgctcagcagaaggggcttcctgcagaccctcaacgccaagctg
agccatgtcctacagagactgacagctttccaggaggacctccccgaagtccaggccttg
gtgaaagtgaagatgtatatctttggggtcaagaataacatccactgcctggcccagctg
cttccagactccgcgaagacagctgaacccactcaagctggtccgggagcctcacggccg
cccactaccaccccagacacttttcagcgcaagatagagggctgtgagttcctgcgtggc
taccaccgcttcatgcactcagtggggcaggtcttctacaagtggagaaagggccccagc
aggagcccgagacacagctcccaccaggccctacaaaggggggctcacgggatgcaaccc
ttcacaaggggcaagggactcctgcctaggggacagttgccccggtag

KEGG   Pteropus alecto (black flying fox): 102889489
Entry
102889489         CDS       T02993                                 

Definition
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102889489
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102889489
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102889489
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102889489
SSDB
Motif
Pfam: PRF CNTF LIF_OSM IL11
Other DBs
NCBI-GeneID: 102889489
NCBI-ProteinID: XP_015446442
LinkDB
Position
Unknown
AA seq 222 aa
MLQNRQEANAEEPGLLGHTEDFSFPSLCLLTLLLPALGPGAPISPAEPISQAYSLALYMQ
KNTSTLLQTYLQYQGSPFCDPGFSAPELQLSSLPPAAVSFKTWHALDDGERLSRAQGAFL
ALTQHLQLVGDDQSDLNPSSPILLAQLRAARLRAQGLLGNIAAIMTSLGLPIPPEEDILG
LVPFEASAFERKCRGYIVTREYRHWTDRAVRDLALLKAKYPG
NT seq 669 nt   +upstreamnt  +downstreamnt
atgctgcagaacagacaggaggctaatgcagaggagccaggccttctgggccacaccgag
gacttcagctttccctccctctgcctgctgaccctgctgctaccagccctcggtccaggg
gcccctatttccccagctgagcccatcagtcaggcctatagcctggccctctacatgcag
aagaatacatcaacactgctgcagacttatctccagtaccaaggcagtcctttttgtgac
cctggcttctcagcccctgagctccagctcagcagcttgcctcctgccgctgtctccttc
aagacctggcatgccttggatgatggggagcggctgagccgtgcccagggggccttcctg
gccttgacccagcatctccagcttgtgggggatgaccagagcgacctgaaccctagcagt
cctatcctgctggctcagctcagggctgcgagactcagggcccaaggcctgttgggcaac
atagctgccattatgacttccctgggcctgcccatccccccagaagaggatattcttggg
cttgtcccctttgaggcctcagcctttgagaggaaatgtagaggctatatagtaacacgg
gaatataggcactggacagatcgagctgttagggacttggctctgctcaaggccaaatac
cctggatag

KEGG   Pteropus alecto (black flying fox): 102889565
Entry
102889565         CDS       T02993                                 

Definition
(RefSeq) interferon lambda-3-like
  KO
K22669  interferon lambda 2/3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102889565
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102889565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102889565
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interferons
   102889565
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 102889565
NCBI-ProteinID: XP_015444684
LinkDB
Position
Unknown
AA seq 127 aa
MDQYLPLWFPEPQNLLFHEVWERPVALEAELALTLKVLETVANSTLGDILDQPLSMLRHI
HARLQACVPAQPTAGPRSQGHLRHWLHRIQEAEKKESQGCLEASVTFNLFRLLTLDLKCV
ASGDLCV
NT seq 384 nt   +upstreamnt  +downstreamnt
atggaccagtatctacctctctggtttccagagccccagaacctcctcttccacgaggtg
tgggagcgccccgtggctttggaggctgagctggctctgacgctgaaggtcctggagacc
gtggccaactcgaccctgggggacatcctggaccagcccctcagcatgctgcgccacatc
cacgccagactccaggcctgtgtcccagctcagcccacggcaggccccaggtcccagggc
cacctccgccactggctgcacaggatccaggaggccgagaagaaggagtcccaaggctgc
ctcgaagcctctgtcacgttcaacctcttccgcctcctcaccttggacctgaaatgtgtc
gccagtggagacctgtgtgtctga

KEGG   Pteropus alecto (black flying fox): 102889807
Entry
102889807         CDS       T02993                                 

Definition
(RefSeq) interferon lambda-3-like
  KO
K22669  interferon lambda 2/3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102889807
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102889807
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102889807
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interferons
   102889807
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 102889807
NCBI-ProteinID: XP_015444685
LinkDB
Position
Unknown
AA seq 201 aa
MAEWQCHIAVEHARWGTAVMITRKYNAATIDTAISFHTILNTPSVHDACMSINDPSWEPE
RLNLQSLNFFWKSQNWSCSSRPFPRTRDLKQLQVWERPVALEAELALTLKVLETVANSTL
GDILDQPLSMLRHIHARLQACVPAQPTAGPRSQGHLRHWLHRIQEAEKKESQGCLEASVT
FNLFRLLTLDLKCVASGDLCV
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcagagtggcagtgtcacattgctgtggagcatgcgagatggggcactgctgtgatg
atcactagaaaatacaacgcggccacaatagacacagctatttccttccatacgatactc
aatactccaagtgtgcacgatgcttgcatgagtataaatgacccttcttgggaaccagag
cgtctaaatctgcagagcctaaactttttctggaagagtcagaactggagctgcagctcc
cgcccattccccaggacccgggacctcaagcagctgcaggtgtgggagcgccccgtggct
ttggaggctgagctggctctgacgctgaaggtcctggagaccgtggctaactcgaccctg
ggggacatcctggaccagcccctcagcatgctgcgccacatccacgccagactccaggcc
tgtgtcccagctcagcccacggcaggccccaggtcccagggccacctccgccactggctg
cacaggatccaggaggccgagaagaaggagtcccaaggctgcctcgaagcctctgtcacg
ttcaacctcttccgcctcctcaccttggacctgaaatgtgtcgccagtggagacctgtgt
gtctga

KEGG   Pteropus alecto (black flying fox): 102889993
Entry
102889993         CDS       T02993                                 

Gene name
IFNK
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04622  RIG-I-like receptor signaling pathway
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102889993 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102889993 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102889993 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102889993 (IFNK)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interferons
   102889993 (IFNK)
SSDB
Motif
Pfam: Interferon Med11
Other DBs
NCBI-GeneID: 102889993
NCBI-ProteinID: XP_006913752
LinkDB
Position
Unknown
AA seq 201 aa
MSTKPHMIRKCLWPACLMGLLITGILSLDCNLLNRVTWQNLKLLSSMRNSFPKDCLRENK
AFEMPQEILYSTQLLKRDIKEAFYEISLQAFNIFSQYTFQSTWKKKYLKRIQIGLHRQLQ
YLEQCLEEEEKENEDMKEMEEDESKYPGAMVSQLTNLELKRYFHRISSFLKDKKYSHCAW
EIVRVEIRRCFCYFTALLRKK
NT seq 606 nt   +upstreamnt  +downstreamnt
atgagcaccaagcctcatatgattagaaagtgtttgtggcctgcatgcctcatgggtctg
ctcatcactggcatcctctctttggactgtaacttgctgaatagagtcacctggcaaaat
ctgaaacttctgagcagtatgaggaattcatttcccaaggattgtctaagagaaaacaaa
gcttttgagatgccccaagagatcctgtattccacacagcttctgaaaagagacatcaaa
gaggccttctatgaaatatccctacaggccttcaacatcttcagtcaatacaccttccaa
tctacttggaaaaagaaatacctcaaacgaatccaaattggacttcatcggcaattgcaa
tacctggaacaatgcttagaagaagaggagaaggaaaatgaagacatgaaagagatggag
gaggatgagagtaaatacccaggagctatggtctcccagctgaccaacctagagctgaag
agatatttccacaggataagcagtttcctgaaagacaagaaatacagtcactgtgcctgg
gagatcgtccgagtagaaatcagaagatgtttctgctacttcacagcactactcaggaaa
aaataa

KEGG   Pteropus alecto (black flying fox): 102890009
Entry
102890009         CDS       T02993                                 

Definition
(RefSeq) interferon alpha-4
  KO
K05414  interferon alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04217  Necroptosis
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04622  RIG-I-like receptor signaling pathway
pale04623  Cytosolic DNA-sensing pathway
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102890009
   04151 PI3K-Akt signaling pathway
    102890009
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102890009
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102890009
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102890009
   04621 NOD-like receptor signaling pathway
    102890009
   04622 RIG-I-like receptor signaling pathway
    102890009
   04623 Cytosolic DNA-sensing pathway
    102890009
   04650 Natural killer cell mediated cytotoxicity
    102890009
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102890009
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102890009
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102890009
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102890009
   05161 Hepatitis B
    102890009
   05160 Hepatitis C
    102890009
   05171 Coronavirus disease - COVID-19
    102890009
   05164 Influenza A
    102890009
   05162 Measles
    102890009
   05168 Herpes simplex virus 1 infection
    102890009
   05163 Human cytomegalovirus infection
    102890009
   05167 Kaposi sarcoma-associated herpesvirus infection
    102890009
   05169 Epstein-Barr virus infection
    102890009
   05165 Human papillomavirus infection
    102890009
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102890009
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interferons
   102890009
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102890009
NCBI-ProteinID: XP_006918398
UniProt: L5K909
LinkDB
Position
Unknown
AA seq 189 aa
MALPFSFLVAVGVLSCHSICSLGCDLPQTHSLVNRRALMLLGQMRRISPFSCLKDREDFG
FPQEAFSGNQFQEAQAITVIHEVTWQTFLLFCTEASSTAWDETLLGRFCTGLYQQLNHLE
ACQTQEVGTEETPLLDEDSTVAVRKYFQRITLYLQEKKHSPCAWEIVRAEIMRSYSLSTH
LKEKSKSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctctgcctttttccttcctggtggccgtgggggtgctcagctgccactccatctgc
tctctgggctgtgacctgcctcagacccacagcctggtcaacaggagggcattgatgctc
ctgggacaaatgaggagaatctctcctttctcctgcctcaaggacagagaagactttgga
ttcccccaggaggcgtttagtggcaaccagttccaggaggctcaagccatcactgtcatc
catgaggtgacctggcagaccttcctcctcttctgcacagaggcttcgtccacagcttgg
gatgagaccctgttaggcagattctgcactggactctatcagcagctgaaccacctggaa
gcctgtcagacgcaggaggtggggacagaggagactcccctgctggatgaggactccacg
gtggctgtgaggaaatacttccagagaatcaccctctatctgcaggagaagaaacacagc
ccttgtgcctgggagattgtcagagcagagatcatgaggtcctactctttatcaacacac
ttgaaggaaaaatcaaagagtaaggattaa

KEGG   Pteropus alecto (black flying fox): 102890025
Entry
102890025         CDS       T02993                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04672  Intestinal immune network for IgA production
pale05140  Leishmaniasis
pale05200  Pathways in cancer
pale05310  Asthma
pale05320  Autoimmune thyroid disease
pale05321  Inflammatory bowel disease
pale05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102890025 (IL4)
   04151 PI3K-Akt signaling pathway
    102890025 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102890025 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102890025 (IL4)
   04660 T cell receptor signaling pathway
    102890025 (IL4)
   04658 Th1 and Th2 cell differentiation
    102890025 (IL4)
   04659 Th17 cell differentiation
    102890025 (IL4)
   04657 IL-17 signaling pathway
    102890025 (IL4)
   04664 Fc epsilon RI signaling pathway
    102890025 (IL4)
   04672 Intestinal immune network for IgA production
    102890025 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102890025 (IL4)
  09163 Immune disease
   05310 Asthma
    102890025 (IL4)
   05320 Autoimmune thyroid disease
    102890025 (IL4)
   05321 Inflammatory bowel disease
    102890025 (IL4)
   05330 Allograft rejection
    102890025 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102890025 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102890025 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102890025 (IL4)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102890025 (IL4)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Cytokines
   102890025 (IL4)
SSDB
Motif
Pfam: IL4 CK2S
Other DBs
NCBI-GeneID: 102890025
NCBI-ProteinID: XP_006923210
LinkDB
Position
Unknown
AA seq 136 aa
MGLTSQLIPALVCLLACTSNFTHGHRYSITLEEIIKTLNILTTRKDWCMELMVADVFAAP
KNTAEDEIFCRAVTVLRKVYKHHECVNRKFLGKLDRNLRSMARDYCPVEEAKKDTLKNVL
ETLRKTMQEKYSKSWS
NT seq 411 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccagctgattccagctctggtgtgcttactagcatgtaccagcaac
ttcacccatggacacaggtacagtatcaccttagaagagatcatcaaaacgctgaacatc
ctcacaacgagaaaggactggtgcatggagctgatggtggcggacgtcttcgctgcccca
aagaacacagcggaggatgaaatcttctgcagggctgtgacggtgcttcggaaggtctac
aaacaccatgagtgcgtaaacagaaaattcctgggcaaacttgacaggaacctgcgcagc
atggccagggactactgtcctgtggaggaagccaagaaggatacattgaaaaacgtcttg
gaaacgctaaggaagaccatgcaagagaaatactcaaagagttggagctga

KEGG   Pteropus alecto (black flying fox): 102890275
Entry
102890275         CDS       T02993                                 

Gene name
IL13
Definition
(RefSeq) interleukin-13
  KO
K05435  interleukin 13
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04664  Fc epsilon RI signaling pathway
pale05200  Pathways in cancer
pale05310  Asthma
pale05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102890275 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102890275 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102890275 (IL13)
   04657 IL-17 signaling pathway
    102890275 (IL13)
   04664 Fc epsilon RI signaling pathway
    102890275 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102890275 (IL13)
  09163 Immune disease
   05310 Asthma
    102890275 (IL13)
   05321 Inflammatory bowel disease
    102890275 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102890275 (IL13)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102890275 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 102890275
NCBI-ProteinID: XP_024896329
LinkDB
Position
Unknown
AA seq 81 aa
MVWNVNLTANPYCAALEFLTNVSDCHAIQRTQRMLSTLCSPKPSSRQVSSQPIRDTKVEV
TRFVKDLLQHLRKIVRHGKLN
NT seq 246 nt   +upstreamnt  +downstreamnt
atggtgtggaacgtcaacctgacagctaacccgtactgtgcagccctggaattcctgacc
aacgtctctgactgccatgccatccaaaggacccagaggatgctgagcacactctgctct
cccaagccctcatctaggcaggtttccagccagcccatcagagacaccaaagttgaggtg
acccggtttgtcaaagacctgctccaacatctgaggaaaattgttcgccatggaaaattg
aattga

KEGG   Pteropus alecto (black flying fox): 102890512
Entry
102890512         CDS       T02993                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04217  Necroptosis
pale04380  Osteoclast differentiation
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04622  RIG-I-like receptor signaling pathway
pale04623  Cytosolic DNA-sensing pathway
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04668  TNF signaling pathway
pale05135  Yersinia infection
pale05142  Chagas disease
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102890512 (IFNB1)
   04668 TNF signaling pathway
    102890512 (IFNB1)
   04151 PI3K-Akt signaling pathway
    102890512 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102890512 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102890512 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102890512 (IFNB1)
   04621 NOD-like receptor signaling pathway
    102890512 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    102890512 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    102890512 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    102890512 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102890512 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102890512 (IFNB1)
   05152 Tuberculosis
    102890512 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102890512 (IFNB1)
   05161 Hepatitis B
    102890512 (IFNB1)
   05160 Hepatitis C
    102890512 (IFNB1)
   05171 Coronavirus disease - COVID-19
    102890512 (IFNB1)
   05164 Influenza A
    102890512 (IFNB1)
   05162 Measles
    102890512 (IFNB1)
   05168 Herpes simplex virus 1 infection
    102890512 (IFNB1)
   05163 Human cytomegalovirus infection
    102890512 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102890512 (IFNB1)
   05169 Epstein-Barr virus infection
    102890512 (IFNB1)
   05165 Human papillomavirus infection
    102890512 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102890512 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102890512 (IFNB1)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interferons
   102890512 (IFNB1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102890512
NCBI-ProteinID: XP_006918399
LinkDB
Position
Unknown
AA seq 185 aa
MTNRCILQFALLLCFSTTALSMSYNWLRFQQRSSNLACLKLLWQLNGTPQYCHKDRMDFK
LPAEIKQPQQFQKEDTVLIIHEMLRQIFDIFQRNFSSTGWNETIIMNLSETLGGQMDRLE
TAMEEMEKENFTWESMTVLHLENYYFRIMRYLETRLYSRCAWTVVKAEILRNFSFLNGLT
EYLQN
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaccaacaggtgcatcctccaatttgctctcctgttgtgtttctccaccacagctctt
tccatgagctacaactggcttcgattccaacaaagaagcagcaatttagcctgcctgaag
ctcctgtggcagttaaatggaactcctcaatattgccacaaggacaggatggacttcaag
ctccctgcggagattaaacaaccacagcagttccagaaggaggataccgtattgatcatc
catgagatgctccggcagatctttgatattttccaaagaaatttctctagcactggctgg
aatgaaaccatcattatgaatctctctgagacactcggtgggcagatggaccgtctggag
acagctatggaggaaatggagaaggaaaacttcacctgggaaagcatgacagtgctgcat
ctagagaattattactttaggatcatgaggtacctggagaccaggttgtacagcagatgt
gcctggacagtagtcaaagcggaaattctcaggaacttttccttccttaatggacttaca
gaatacctccaaaactga

KEGG   Pteropus alecto (black flying fox): 102890771
Entry
102890771         CDS       T02993                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04660  T cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04672  Intestinal immune network for IgA production
pale05200  Pathways in cancer
pale05310  Asthma
pale05320  Autoimmune thyroid disease
pale05321  Inflammatory bowel disease
pale05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102890771 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102890771 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102890771 (IL5)
   04660 T cell receptor signaling pathway
    102890771 (IL5)
   04658 Th1 and Th2 cell differentiation
    102890771 (IL5)
   04657 IL-17 signaling pathway
    102890771 (IL5)
   04664 Fc epsilon RI signaling pathway
    102890771 (IL5)
   04672 Intestinal immune network for IgA production
    102890771 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102890771 (IL5)
  09163 Immune disease
   05310 Asthma
    102890771 (IL5)
   05320 Autoimmune thyroid disease
    102890771 (IL5)
   05321 Inflammatory bowel disease
    102890771 (IL5)
   05330 Allograft rejection
    102890771 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102890771 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102890771 (IL5)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102890771 (IL5)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Cytokines
   102890771 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 102890771
NCBI-ProteinID: XP_006923213
LinkDB
Position
Unknown
AA seq 134 aa
MRMLLHLSFLSLGAVYICAIAVESPMNRLVAETLTLLSTHQTLLIGDGNLMIPTPEHKNH
QLCIEEVFQGIDTLKNQTAQGDAVEKLFQNLSLIKKYIDSQKKKCEGERWRVKKFLDYLQ
VFLGVINTEWTMES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagaatgcttctgcatttgagtttcctatctcttggggctgtctacatttgtgccatt
gctgtagaaagtcccatgaatagactggtggcagagaccttgacactgctctccactcat
cagactctgctgataggcgatgggaacctgatgattcctactcctgaacataaaaatcac
cagttatgcattgaagaagtctttcaggggatagacacattgaagaatcaaactgcgcaa
ggggatgccgtggaaaaactattccaaaacttgtctttaataaaaaaatacatagacagc
caaaaaaaaaagtgtgaaggagaacgatggagagtaaaaaaattcctagactacctgcaa
gtgtttcttggtgtaataaacactgaatggacaatggaaagttga

KEGG   Pteropus alecto (black flying fox): 102893042
Entry
102893042         CDS       T02993                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale04650  Natural killer cell mediated cytotoxicity
pale04657  IL-17 signaling pathway
pale04660  T cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04668  TNF signaling pathway
pale05146  Amoebiasis
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05171  Coronavirus disease - COVID-19
pale05202  Transcriptional misregulation in cancer
pale05221  Acute myeloid leukemia
pale05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102893042 (CSF2)
   04668 TNF signaling pathway
    102893042 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102893042 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102893042 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    102893042 (CSF2)
   04660 T cell receptor signaling pathway
    102893042 (CSF2)
   04657 IL-17 signaling pathway
    102893042 (CSF2)
   04664 Fc epsilon RI signaling pathway
    102893042 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102893042 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102893042 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102893042 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102893042 (CSF2)
   05171 Coronavirus disease - COVID-19
    102893042 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102893042 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102893042 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pale03019]
    102893042 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102893042 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102893042 (CSF2)
Messenger RNA biogenesis [BR:pale03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     102893042 (CSF2)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102893042 (CSF2)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Cytokines
   102893042 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 102893042
NCBI-ProteinID: XP_006923224
UniProt: L5JVN3
LinkDB
Position
Unknown
AA seq 144 aa
MWLQNLLLLGTVVCSISAPTRPPSPVTRPFQHVDAIKEALSILNHSNDTADMMNETVEVV
SEIFDPQEPTCVQTRLKLYTQGLRGSLTRLKGPLTMMASYYEQHCPRTLETSCATQIITL
KNFKKNLHDFLLNIPFDCWEQVQK
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggctacagaacctgcttctcctgggcactgtggtctgcagcatctccgcacccacc
cgtccacccagccctgttacccggccctttcaacatgtggatgccatcaaggaggccctg
agcattctgaaccacagtaatgacaccgctgatatgatgaatgaaactgtagaagtcgtc
tctgaaatctttgacccccaggagccgacatgtgtgcagacccgcctgaagctgtacaca
cagggcttgcggggcagcctcaccaggctcaagggccccttaaccatgatggccagctac
tatgagcagcactgtccccgtaccctggaaacttcctgtgcaacccagattatcaccttg
aagaatttcaagaagaacctgcatgactttctacttaacatcccctttgactgctgggag
caagtgcagaagtga

KEGG   Pteropus alecto (black flying fox): 102893643
Entry
102893643         CDS       T02993                                 

Gene name
IFNE
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04622  RIG-I-like receptor signaling pathway
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102893643 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102893643 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102893643 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102893643 (IFNE)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interferons
   102893643 (IFNE)
SSDB
Motif
Pfam: Interferon Coatomer_WDAD
Other DBs
NCBI-GeneID: 102893643
NCBI-ProteinID: XP_006908417
UniProt: L5KXU3
LinkDB
Position
Unknown
AA seq 193 aa
MISKYFFEVVLVLLASSTVFSLELKLVLFQQRRVNRENLKLLNKLQTSSIHQCLPHRKNF
LLPQKSLNPHLYQKGCALAFLHETLQQIFSLFGANIFLDGWEESHMEKFLIELHQQLEYL
ETLMRQQTEQKSGTLGSENLRLQVKMYFQRIRDYLENQEYSRCAWTIVQVEINRCLFFVF
QLTGKLSKQEMDP
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattagcaagtacttctttgaagttgtgttggtgctgctggcctcttccactgtcttc
tccctagaactgaaactggttcttttccaacaaagaagagtgaacagagaaaatttaaaa
ctcttgaataaattgcaaacctcgtcaattcatcagtgtctaccacacaggaaaaacttt
ctgcttccccagaagtctctgaatcctcacctgtaccagaaaggatgtgcactggccttt
cttcatgagacgcttcagcagatcttcagcctattcggggcaaatatttttctggatggt
tgggaggaaagccacatggagaagttcctcattgaacttcatcaacaactggaataccta
gaaacgctcatgagacagcaaacagaacagaaaagtggcaccttaggtagtgagaacctt
aggttacaggttaaaatgtacttccaaaggatccgtgattacctggaaaaccaggaatac
agccgctgtgcctggaccattgtccaagtagaaatcaaccggtgtcttttctttgtgttc
caacttacaggaaagctgagcaaacaagaaatggacccttga

KEGG   Pteropus alecto (black flying fox): 102893886
Entry
102893886         CDS       T02993                                 

Definition
(RefSeq) interferon alpha-1
  KO
K05414  interferon alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04217  Necroptosis
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04622  RIG-I-like receptor signaling pathway
pale04623  Cytosolic DNA-sensing pathway
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102893886
   04151 PI3K-Akt signaling pathway
    102893886
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102893886
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102893886
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102893886
   04621 NOD-like receptor signaling pathway
    102893886
   04622 RIG-I-like receptor signaling pathway
    102893886
   04623 Cytosolic DNA-sensing pathway
    102893886
   04650 Natural killer cell mediated cytotoxicity
    102893886
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102893886
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102893886
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102893886
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102893886
   05161 Hepatitis B
    102893886
   05160 Hepatitis C
    102893886
   05171 Coronavirus disease - COVID-19
    102893886
   05164 Influenza A
    102893886
   05162 Measles
    102893886
   05168 Herpes simplex virus 1 infection
    102893886
   05163 Human cytomegalovirus infection
    102893886
   05167 Kaposi sarcoma-associated herpesvirus infection
    102893886
   05169 Epstein-Barr virus infection
    102893886
   05165 Human papillomavirus infection
    102893886
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102893886
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interferons
   102893886
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102893886
NCBI-ProteinID: XP_006908418
LinkDB
Position
Unknown
AA seq 189 aa
MALPCSFLVAVVVLSCHSICSLGCDLPQTHSLVNRRALMLLGQMRRISPFSCLKDREDFG
FPQGAFGGNQFQEAQAIAVVHEVTRQTFHLFCTEVSSAAWDETLLGRFCTGLYQQLNHLE
ACQTQEVGTEETPLLDEDSTLAVRKYFQRITLYLQEKKHSPCAWEIVRAEVMRSYSLSTH
FQERSRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgccctgttctttcctggtggctgtggtggtgctcagctgccactccatctgc
tctctgggctgtgacctgcctcagacccacagcctggtcaacaggagggcattgatgctc
ctgggacaaatgaggagaatctctcctttctcctgcctcaaggacagagaagactttgga
ttcccccagggggcgtttggtggcaaccagttccaggaggctcaagccatcgctgtcgtc
catgaggtgacccggcagaccttccacctcttctgcacagaggtctcgtccgcagcttgg
gatgagaccctgcttggcagattctgcactggactctatcagcagctgaaccacctggaa
gcctgtcaaacgcaggaggtggggacggaggagactcccctgctggatgaggactccaca
ctggctgtgaggaaatacttccagagaatcaccctctatctgcaggagaagaaacacagc
ccttgtgcctgggagattgtcagagcagaggtcatgagatcctactccttatcaacgcac
tttcaggaaagatcaaggagtaaggattga

KEGG   Pteropus alecto (black flying fox): 102894035
Entry
102894035         CDS       T02993                                 

Gene name
IFNL1
Definition
(RefSeq) interferon lambda-1 precursor
  KO
K05447  interferon lambda 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102894035 (IFNL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102894035 (IFNL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102894035 (IFNL1)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interferons
   102894035 (IFNL1)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 102894035
NCBI-ProteinID: NP_001277100
UniProt: F6KEX6
LinkDB
AA seq 191 aa
MAVAWCLVLVLVAAGLGLAGASPVPTSMPTSAGRSCNIGKFKSLLPTEWKAFKKAKDALE
NSLKNQSCSFSLFPRNWKLTELQVWERPMALEAELALTLKVLETKADSSLGDILDQPLHT
LRHIHSELQACVSPQPTASPRPHGRLHHWLHRLQKAPKKVSQDCLESTVTFNLFRLLTRD
LKCVAREDLCV
NT seq 576 nt   +upstreamnt  +downstreamnt
atggctgtagcctggtgcctggtgcttgtgctggtggctgcggggctgggcttggccgga
gcaagccctgttcccacttccatgcccacctcagctggaaggagttgcaacattggcaag
ttcaaatctctgctaccaacggagtggaaggccttcaagaaagccaaggacgctttggaa
aattcactgaaaaaccagagctgcagcttctcactcttccccagaaactggaaactgaca
gagctgcaagtatgggagcgccccatggctttggaggctgaactggccctgacactaaag
gtcctagagaccaaggctgactcatccctgggagacatcctggaccagccccttcataca
ctgcgccacatccactctgaactccaggcctgcgtctcacctcagcccacagcaagtccc
aggccccatggccgcctccaccactggctgcaccggctccagaaggccccaaagaaagtg
tctcaagactgcctcgaatctactgtcacattcaacctcttccgcctccttacaagagat
ctgaagtgtgtcgccagggaagatctatgtgtctga

KEGG   Pteropus alecto (black flying fox): 102894127
Entry
102894127         CDS       T02993                                 

Definition
(RefSeq) interferon omega-2
  KO
K05440  interferon omega
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04622  RIG-I-like receptor signaling pathway
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102894127
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102894127
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102894127
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102894127
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interferons
   102894127
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102894127
NCBI-ProteinID: XP_024900084
LinkDB
Position
Unknown
AA seq 195 aa
MAPLLSLLTALLLFNYGPSGSLGCDLSQDHVEVSKENIALLHRMQRISSFRCRKDRKNFG
FLREMVDGSHIQKAQAISVLHEMLQETSIIFGSEQSSTAWNMTLLHGLLSGLHRQLEDLG
TCLVPQMKEAESALGMEDPTLAVKRYFQGIHLYLKEKQYSDCAWEIIRVEIKRAFSLSTN
LLERLGNQDRDLGSL
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccccctgctctctctactcacggccctgctgctattcaactatggtcccagtggg
tctctgggctgtgacctgtctcaggaccacgtcgaggtcagcaaggagaacatcgcgctt
ctgcaccgaatgcagagaatcagctctttccgctgtcgaaaggacagaaagaacttcgga
ttcctacgggagatggtggatggcagccacatccagaaggctcaggccatctctgtcctc
catgagatgctccaggagacctccatcatctttggctcagagcagtcctcaacagcctgg
aacatgaccctgctgcacgggctactcagtggactccatcggcagttggaagacctgggc
acctgtttggtgccacagatgaaagaagcggaatctgccctgggaatggaggacccaaca
ttggctgtgaagagatactttcagggcatccatctctacctcaaagagaagcaatacagt
gactgtgcctgggagatcatcagagtggaaatcaagagagccttctctttatcaacaaac
ttgctagaaaggttaggaaaccaggatagagacctggggtctctttga

KEGG   Pteropus alecto (black flying fox): 102894278
Entry
102894278         CDS       T02993                                 

Gene name
IL9
Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale05310  Asthma
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102894278 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102894278 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102894278 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102894278 (IL9)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102894278 (IL9)
SSDB
Motif
Pfam: Dynamin_M
Other DBs
NCBI-GeneID: 102894278
NCBI-ProteinID: XP_006923395
LinkDB
Position
Unknown
AA seq 141 aa
MLPTVVLASAFLFCSVASQGCLTLVGIKDIKYLIDNLQRDPSSNCSCSGNVTSCLCLPTP
SDNCTTPCFQEGLSLMANTTVKTSFPLIFNRVKRTVEALKNNKCQFFSCEQSCNQTTAGN
TLTFLKSLLGIFQKERMRSST
NT seq 426 nt   +upstreamnt  +downstreamnt
atgctcccaaccgtggtccttgcttctgcctttctcttctgctcggtggccagccagggg
tgtttgaccttggtagggatcaaggacatcaaatacctcattgacaacctgcagagagat
ccatcttcaaattgcagctgcagtggcaatgtgaccagttgtttgtgtctgcccactcct
tctgacaactgcaccacgccatgcttccaagagggtctgtcactgatggccaacaccaca
gtgaaaacaagtttccccctaattttcaatcgggtgaaaagaacagttgaagccctgaag
aacaacaagtgtcaatttttttcctgtgaacagtcatgcaaccaaaccacagcaggcaac
acactgacatttctgaagagtctcctgggaatcttccagaaagaaaggatgagaagcagc
acatga

KEGG   Pteropus alecto (black flying fox): 102895516
Entry
102895516         CDS       T02993                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04151  PI3K-Akt signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04672  Intestinal immune network for IgA production
pale04940  Type I diabetes mellitus
pale05135  Yersinia infection
pale05142  Chagas disease
pale05162  Measles
pale05166  Human T-cell leukemia virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05320  Autoimmune thyroid disease
pale05321  Inflammatory bowel disease
pale05330  Allograft rejection
pale05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102895516 (IL2)
   04151 PI3K-Akt signaling pathway
    102895516 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102895516 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102895516 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102895516 (IL2)
   04660 T cell receptor signaling pathway
    102895516 (IL2)
   04658 Th1 and Th2 cell differentiation
    102895516 (IL2)
   04659 Th17 cell differentiation
    102895516 (IL2)
   04672 Intestinal immune network for IgA production
    102895516 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102895516 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102895516 (IL2)
   05321 Inflammatory bowel disease
    102895516 (IL2)
   05330 Allograft rejection
    102895516 (IL2)
   05332 Graft-versus-host disease
    102895516 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102895516 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102895516 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102895516 (IL2)
   05171 Coronavirus disease - COVID-19
    102895516 (IL2)
   05162 Measles
    102895516 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102895516 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102895516 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102895516 (IL2)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102895516 (IL2)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Cytokines
   102895516 (IL2)
SSDB
Motif
Pfam: IL2 MutS_III TIG_plexin AATF-Che1
Other DBs
NCBI-GeneID: 102895516
NCBI-ProteinID: XP_006917814
UniProt: L5K7D9
LinkDB
Position
Unknown
AA seq 152 aa
MHKMYFLSCIALTLALVADGAPTSSSRKETQQQLEHLLKDLQRLLETVNNYKNHELSSML
TFKFYMPNATELNHLQCLVDELKPLEEVLTIAQSKNSHSDIKESVSNINVTAQKLKGPET
KYTCVYNDESANVKEFLNKWITFCQSILSTLA
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcacaagatgtacttcttgtcttgcattgcactaactcttgcactggtggcagacggt
gcacctacttcaagctctaggaaggaaacacagcaacagctggagcatttgctgaaggac
ttacagcggcttttggagacagttaataattacaagaatcacgaactctccagcatgctc
acctttaaattttacatgcccaatgccacagaactgaatcatctgcagtgcctcgtggac
gaactcaaacctttggaggaagtgctaactatagctcaaagcaaaaactctcactcagac
atcaaggagtcagtgagcaatatcaacgtaacagctcagaaactaaagggacctgaaaca
aaatacacatgtgtctataatgatgagagcgcgaacgttaaagaatttctgaacaaatgg
attaccttttgtcaaagcatcctctcgacactggcttaa

KEGG   Pteropus alecto (black flying fox): 102895746
Entry
102895746         CDS       T02993                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01523  Antifolate resistance
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04218  Cellular senescence
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04623  Cytosolic DNA-sensing pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale04657  IL-17 signaling pathway
pale04659  Th17 cell differentiation
pale04668  TNF signaling pathway
pale04672  Intestinal immune network for IgA production
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05010  Alzheimer disease
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05133  Pertussis
pale05134  Legionellosis
pale05135  Yersinia infection
pale05142  Chagas disease
pale05143  African trypanosomiasis
pale05144  Malaria
pale05146  Amoebiasis
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05321  Inflammatory bowel disease
pale05323  Rheumatoid arthritis
pale05332  Graft-versus-host disease
pale05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102895746 (IL6)
   04668 TNF signaling pathway
    102895746 (IL6)
   04066 HIF-1 signaling pathway
    102895746 (IL6)
   04068 FoxO signaling pathway
    102895746 (IL6)
   04151 PI3K-Akt signaling pathway
    102895746 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102895746 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102895746 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102895746 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102895746 (IL6)
   04620 Toll-like receptor signaling pathway
    102895746 (IL6)
   04621 NOD-like receptor signaling pathway
    102895746 (IL6)
   04623 Cytosolic DNA-sensing pathway
    102895746 (IL6)
   04625 C-type lectin receptor signaling pathway
    102895746 (IL6)
   04659 Th17 cell differentiation
    102895746 (IL6)
   04657 IL-17 signaling pathway
    102895746 (IL6)
   04672 Intestinal immune network for IgA production
    102895746 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102895746 (IL6)
   05202 Transcriptional misregulation in cancer
    102895746 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102895746 (IL6)
   05321 Inflammatory bowel disease
    102895746 (IL6)
   05332 Graft-versus-host disease
    102895746 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102895746 (IL6)
   05020 Prion disease
    102895746 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    102895746 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102895746 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102895746 (IL6)
   04931 Insulin resistance
    102895746 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102895746 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102895746 (IL6)
   05135 Yersinia infection
    102895746 (IL6)
   05133 Pertussis
    102895746 (IL6)
   05134 Legionellosis
    102895746 (IL6)
   05152 Tuberculosis
    102895746 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102895746 (IL6)
   05161 Hepatitis B
    102895746 (IL6)
   05171 Coronavirus disease - COVID-19
    102895746 (IL6)
   05164 Influenza A
    102895746 (IL6)
   05162 Measles
    102895746 (IL6)
   05168 Herpes simplex virus 1 infection
    102895746 (IL6)
   05163 Human cytomegalovirus infection
    102895746 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102895746 (IL6)
   05169 Epstein-Barr virus infection
    102895746 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102895746 (IL6)
   05144 Malaria
    102895746 (IL6)
   05142 Chagas disease
    102895746 (IL6)
   05143 African trypanosomiasis
    102895746 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102895746 (IL6)
   01523 Antifolate resistance
    102895746 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102895746 (IL6)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102895746 (IL6)
SSDB
Motif
Pfam: IL6 IL11 DUF4924 GCSF IL23 Phage_int_SAM_1
Other DBs
NCBI-GeneID: 102895746
NCBI-ProteinID: XP_006912045
LinkDB
Position
Unknown
AA seq 209 aa
MNSFCTSAFRPVAFSLGLLLVMATALPIPVPSGEDSKDDTNSNRPQLTSPNQTENLIKSI
FLEISEVRNKMCGNDDSCKNSKEVLTENNLNLPKMAEKDGCFQSGFNQETCLMKITTGLL
EFQIYLDYLQNKFEENAKAMQMRTKALVQVLKQKVKNPNEITTPDPTTNSSLLAKLQSQS
EWLQTTTIHLILRSLEDFLQFTQRAVRIM
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaactccttctgcacaagcgctttcaggccagtcgccttctccctggggctgctgcta
gtgatggctactgctctccctattccggttccctccggagaagattccaaagatgatacc
aactcaaacagaccacaactcacctctccaaaccaaaccgaaaacctcattaagtccatc
ttccttgaaatctctgaagtgagaaataagatgtgtggcaacgatgactcatgtaaaaac
agcaaggaggtactgacagaaaacaacctgaaccttccaaaaatggcagaaaaagatgga
tgcttccagtcggggttcaatcaggagacctgcttgatgaaaatcactaccggtctcctg
gagtttcagatatacctggactacctccagaacaagtttgaggaaaacgccaaggcgatg
cagatgcgaaccaaagccctggtccaggtgctgaagcagaaggtaaagaatccaaatgag
ataaccacccctgacccaaccacaaactccagcctgctggctaagctgcagtcgcagagc
gaatggctgcagaccacgacaattcacctcatcctgcgaagccttgaggatttcctgcag
ttcactcagagggctgtccggataatgtag

KEGG   Pteropus alecto (black flying fox): 102895772
Entry
102895772         CDS       T02993                                 

Gene name
IL21
Definition
(RefSeq) interleukin-21
  KO
K05434  interleukin 21
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04659  Th17 cell differentiation
pale05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102895772 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102895772 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102895772 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    102895772 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102895772 (IL21)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102895772 (IL21)
SSDB
Motif
Pfam: IL15 Vta1 MtrB
Other DBs
NCBI-GeneID: 102895772
NCBI-ProteinID: XP_006917815
LinkDB
Position
Unknown
AA seq 146 aa
MERIIIYLMVIFSGTVAHKSSLQGQDRLLTRMRQLIDIVEQLKNYVNDLEPELLPAPEGV
KRHCERSAFSCFQKVQLKPANAGDNEKTINVLTKQLMRKLPPVNSGRRQKQRLTCPSCDS
YEKKPPKEFLERLESLIQKMIHQHLS
NT seq 441 nt   +upstreamnt  +downstreamnt
atggagaggataatcatctacctgatggtcatcttctcggggacagtggcccataagtca
agcctccaagggcaagatcgcctcttgactagaatgcgtcaacttatagatattgttgag
cagctgaaaaattatgtgaatgacttggaacctgaacttctaccagctccagaaggtgta
aagagacactgtgagcggtcggctttctcatgttttcagaaggtccagctgaagccggca
aatgcgggagacaacgagaagaccatcaacgtgctgactaagcagctgatgaggaaactc
cctcccgtaaattcagggagaagacagaaacagagactaacatgcccttcatgtgattct
tatgagaaaaagccacccaaggaattcctagaaagactggaatcgctcatccaaaagatg
atccatcagcatctctcctag

KEGG   Pteropus alecto (black flying fox): 102896574
Entry
102896574         CDS       T02993                                 

Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale04664  Fc epsilon RI signaling pathway
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05221  Acute myeloid leukemia
pale05310  Asthma
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102896574
   04151 PI3K-Akt signaling pathway
    102896574
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102896574
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102896574
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102896574
   04664 Fc epsilon RI signaling pathway
    102896574
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102896574
   05202 Transcriptional misregulation in cancer
    102896574
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102896574
  09163 Immune disease
   05310 Asthma
    102896574
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102896574
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102896574
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102896574
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Cytokines
   102896574
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 102896574
NCBI-ProteinID: XP_006923401
LinkDB
Position
Unknown
AA seq 149 aa
MHPTSPKMSSLPILHLLLLLLTAYASQAQGLPLPTSSTKEYVNMMMREIESILNKPPLPP
QEPLDVNEIYILNNEAFLMLNLDTFLEAAKNLQDKGMRIGKILEKLKETISSAPMTTEEP
IYIKKGNWDDFWRKMTKYLNFLQNYLKKS
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcatcctaccagcccaaagatgagcagcctccccatcctgcaccttctcctgctcctg
ctcacagcctatgcctctcaagcacaggggctgcccttgccgacgagctcgaccaaggaa
tacgtcaacatgatgatgagggaaattgagagcatcctgaacaaaccgcctttgcctcca
caagaaccgttggacgtaaatgagatatacatcctgaacaatgaggcctttctgatgcta
aacctggataccttcctggaagctgccaagaatttgcaggataaaggaatgagaattggg
aaaattcttgagaaactcaaagagacaatctcgtccgcccccatgaccacggaagagcca
atctatatcaagaaaggtaactgggacgatttctggaggaaaatgactaaatatctgaac
ttccttcagaactacctcaagaagtcctag

KEGG   Pteropus alecto (black flying fox): 102896930
Entry
102896930         CDS       T02993                                 

Definition
(RefSeq) interferon omega-2-like
  KO
K05440  interferon omega
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04622  RIG-I-like receptor signaling pathway
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102896930
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102896930
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102896930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102896930
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interferons
   102896930
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102896930
NCBI-ProteinID: XP_024900083
LinkDB
Position
Unknown
AA seq 152 aa
MQNSFSCWKDTKNFRFPLEMVDGSQVQEAQAISVLHEMLQETFDVFCTEHSSAAWNTTLQ
HGLLTGLHRQLEDLGICLVPEMKEVESALGMEDPTLAVKRYFQGIRLYLKEKRYSDCAWE
VVRVEIKEILLFINKLTKKVMKSGWRPGVTLK
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcagaactcttttagttgttggaaggacacaaagaacttcagattccccttggagatg
gtggatggcagccaggtccaggaggcccaggctatctctgtcctccacgagatgctccag
gagacctttgacgtcttctgcacagagcactcctctgctgcctggaacacgactctgcag
cacgggctcctcactggactccatcggcagctggaagacctgggcatctgtttggtgcca
gagatgaaagaagtagaatctgccctgggaatggaggaccctacactggccgtgaagagg
tacttccagggcatccgtctctacctcaaagagaagcgatacagtgactgtgcctgggag
gttgtcagagtggaaattaaggaaatccttctctttatcaacaaacttactaaaaaggtt
atgaaatcaggatggagacctggggtcaccttgaaatga

KEGG   Pteropus alecto (black flying fox): 102896947
Entry
102896947         CDS       T02993                                 

Gene name
TSLP
Definition
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102896947 (TSLP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102896947 (TSLP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102896947 (TSLP)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102896947 (TSLP)
SSDB
Motif
Pfam: TSLP
Other DBs
NCBI-GeneID: 102896947
NCBI-ProteinID: XP_015445833
LinkDB
Position
Unknown
AA seq 221 aa
MGSPSTLPDALLFVLSVFFRKIFILQLVGLVLTHNFTDCDFEKIRTTYREVIFGKLNSYM
NGTKCTLCNNYVYCKDRPDCLSKIVLLTFYPTHGCTSLAKEIFAMKTNATLTLQCPGYSG
IRVSGCRALLLFNILELTLYQSGVSVQCKSRCDFYSVSIFRRANELGKSCRPTLTSPPRS
NYFEGSDSLRRIMVLNLRPVFHGMITEPPISECPGCLSVGR
NT seq 666 nt   +upstreamnt  +downstreamnt
atggggtctccgagtacattgcctgatgccttattatttgttctttcagtttttttcagg
aagatcttcattttgcaactggtagggctggtgctaacccacaatttcactgactgtgac
tttgagaagattagaacaacttatcgggaagtaattttcggaaagctgaactcatatatg
aatgggaccaaatgtaccctgtgcaacaactatgtttactgtaaagaccggccggattgc
ctctctaaaatcgtgctccttacgttctatcccacccacggctgcacgtcactcgccaag
gaaatcttcgcaatgaaaactaatgctacgctcactctccagtgcccaggctactccgga
attcgggtaagcggatgccgcgcacttttactttttaatatcttagagctaaccttgtat
caaagcggggtttccgtgcaatgcaaaagtcgttgtgatttttattcagtttctatcttt
cgacgagcaaatgaactgggtaaaagctgtagacccacgttgacgtctccacccagatcc
aactatttcgagggttctgattctttacgcagaattatggttctaaaccttaggccagtg
tttcatggtatgattactgagcctcctatatcggaatgtcctggctgcttgagcgtggga
aggtga

KEGG   Pteropus alecto (black flying fox): 112472586
Entry
112472586         CDS       T02993                                 

Gene name
IL7
Definition
(RefSeq) interleukin-7
  KO
K05431  interleukin 7
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112472586 (IL7)
   04151 PI3K-Akt signaling pathway
    112472586 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112472586 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112472586 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112472586 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    112472586 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    112472586 (IL7)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   112472586 (IL7)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Cytokines
   112472586 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 112472586
NCBI-ProteinID: XP_024896887
LinkDB
Position
Unknown
AA seq 240 aa
MRSLKNMNVNCVTVLGRVDSLRSIAEKKELDHSVGPGLLFCCPSRHLSLPVYLEMPFLVE
MFNVLSILVSFRYIFGIPPLILVLLPVASSDCEIEGKNGEEYQHVLMVSLRELDRRENES
NCLDNEPNFFKKHSCDDNKEATFLKSAARKLKQFLKMNIQEEFKHHLTVLSQGTLKLLNC
TRKEKEKKQPSLGEAQPTKNLEEKKSLKEQKKLDEMCFLKILLEKIKTCWNKILSGTKEH
NT seq 723 nt   +upstreamnt  +downstreamnt
atgaggagtctcaaaaatatgaatgtcaactgtgtcacagttttgggaagggtagactcc
ttaaggtccatcgctgaaaagaaagagcttgatcacagcgtaggacctggcctactattc
tgctgcccgtcgcgtcatctgagtttacctgtttacctggagatgccttttcttgtagag
atgtttaatgtactgtcgattttagtttcttttaggtatatctttggaattcctcccctg
atccttgttctgctgccagtagcgtcatctgactgtgagattgaaggtaaaaacggtgaa
gagtatcagcacgttctgatggtcagcctccgtgagctggacaggagagaaaatgagagc
aattgcctggataatgaacctaacttttttaaaaagcattcatgtgatgataataaggaa
gctacgtttttaaaaagtgctgctcgcaagttgaagcaatttcttaaaatgaatatccag
gaggaattcaagcaccacttaacagtactttcacagggcacattgaaactgctgaactgc
accaggaaggaaaaagaaaaaaaacaaccttccttgggtgaagcccaacccactaagaat
ttggaagagaaaaaatctttaaaggaacagaaaaaactggatgaaatgtgtttcctaaag
atactactagaaaagataaaaacctgttggaataaaattctgagtggcactaaagagcat
tga

DBGET integrated database retrieval system