KEGG   Pteropus alecto (black flying fox): 102879554
Entry
102879554         CDS       T02993                                 

Gene name
TOP2B
Definition
(RefSeq) DNA topoisomerase 2-beta
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:pale00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102879554 (TOP2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pale03032]
    102879554 (TOP2B)
   03036 Chromosome and associated proteins [BR:pale03036]
    102879554 (TOP2B)
Enzymes [BR:pale01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     102879554 (TOP2B)
DNA replication proteins [BR:pale03032]
 Eukaryotic type
  DNA Topoisomerases
   102879554 (TOP2B)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    102879554 (TOP2B)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102879554 (TOP2B)
SSDB
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB DTHCT HATPase_c Toprim
Other DBs
NCBI-GeneID: 102879554
NCBI-ProteinID: XP_024894821
LinkDB
Position
Unknown
AA seq 1542 aa
MWVYDEDVGMNCRDITFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWN
NGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDEEKKVTGGRNGYGAKLCNIFSTKFTVE
TACKEYKHSFKQTWMNNMMKTSESKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMT
RRVYDLAGSCKGVKVIFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVC
LTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVKPFQVKNHI
WVFINCLIENPTFDSQTKENMTLQPKNFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQ
TQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDR
YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMT
DQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKK
HIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDD
RKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVD
GFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNN
INLLQPIGQFGTRLHGGKDAASPRYIFTMLSSLARRLFPPVDDNLLKFLYDDNQRVEPEW
YIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQ
ELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEY
HTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILK
EFFDLRLSYYGLRREWLVGMLGAESAKLNNQARFILEKIQGKITIENRSKKDLIQMLVQR
GYESDPVKAWKEAQEKATEEEETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEE
LIKQRDAKGREVNDLKRKSPSDLWKEDLAAFAEELDKVEAQEREDILAGMAGRTIKGKVG
KPKVKKLQLDETMPSPYGRRIVPEITAMKADASKKLLKKKKGDLDTTTVKVEFDEEFSGT
PVEGTGEEALIQSVPVNKGPKPKREKKEPGTRVRKTPTSSGKSSAKKVKKRNPWSDDESK
SESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDDDADDDDDNNDLEELKVKASPI
TNDGEDEFVPSDGLDKDEYTFSPGKSKTIPEKSSHDKKSQDFGNLFSFPSYSQKSEDDSA
KFDSNEEDSASVFSPSFGLKQTDKVPSKTVAAKKGKPSSDTTPKPKRTPKQKKVETINSD
SDSEFGIPKKTTTPKGKGRGAKKRKASGSENEGDYNPGRKTSKTPSKKPKKTSFDQDSDV
DIFPSDFTSEPPSLPRTGRARKEVKYFAESDEEEDVDFAMFN
NT seq 4629 nt   +upstreamnt  +downstreamnt
atgtgggtgtatgatgaagatgtaggaatgaattgcagggatattaccttcgtgccaggt
ttatacaagatctttgatgaaatcttggttaatgcagctgacaataaacagagggataag
aacatgacctgtattaaagtttctattgatcctgaatctaacattataagcatttggaat
aatgggaaaggcattccagtggtagaacacaaagtagagaaagtttatgttccagcgtta
atttttggacagcttttaacatccagtaactatgatgatgaggagaaaaaagtaacaggt
ggtcgcaatggttatggtgcaaaactttgtaatattttcagtacaaagtttacagtagaa
actgcttgcaaagaatacaaacatagttttaagcagacctggatgaataatatgatgaag
acttctgaatccaaaattaaacatttcgatggtgaagattacacttgcataacattccaa
ccagatctgtccaaatttaagatggaaaaacttgacaaggatattgtggctctcatgacc
agaagagtttatgatctggctggttcatgcaaaggggtcaaggtcatatttaatggaaag
aaattgcctgtaaatggatttcgcagttatgtagatctttatgtgaaagacaaattggat
gaaactggagtggctctgaaagttattcatgaacttgcaaatgaaagatgggatgtttgt
cttacattgagtgaaaaaggattccagcaaatcagctttgtaaatagtatcgcaacaaca
aaaggtggacggcatgtggattatgtagtagatcaagttgttggtaaactgattgaagta
gtgaagaaaaagaacaaagctggtgtatcagtgaaaccatttcaagtaaaaaaccatata
tgggtttttattaattgccttatcgaaaatccaacttttgattctcagactaaagaaaac
atgactttgcagcccaaaaattttgggtccaaatgtcaactgtcagaaaaatttttcaaa
gcagcctctaactgtggcattgtagaaagtatcctgaactgggtgaaatttaaggctcag
actcagctgaacaagaagtgttcatcagtaaagtacagtaaaattaaaggtattcccaaa
ctggatgatgctaatgatgctggtggcaaacattccctagagtgtacactgatactaaca
gagggagactcagccaaatcactggctgtgtctggattaggtgtgatcgggcgagacaga
tatggagtctttccactcaggggaaaaattcttaatgtacgagaagcttctcataaacag
atcatggaaaatgcagaaataaacaatattattaaaatagttggtctacaatacaaaaaa
agttatgatgatgcagaatctctgaaaactttacgctatggaaagattatgattatgact
gatcaggatcaagatggttctcatataaaaggccttcttattaatttcatccatcacaat
tggccatcacttttgaagcatggttttcttgaagagttcattactccaattgtaaaggca
agcaaaaataagcaggaactttccttctacagtattcccgaatttgatgagtggaaaaaa
catatagaaaaccagaaagcctggaaaataaaatactacaaaggattgggtaccagtaca
gctaaagaagcaaaggaatattttgctgatatggaaaggcaccgcatcttgtttagatat
gctggtcctgaagatgatgctgccattaccttggcgttcagtaaaaagaagatcgatgac
agaaaagaatggttaacaaattttatggaagaccggagacagcgtaggttacatggctta
ccagagcaatttttatatggtacagcgacaaagcatttgacgtacaatgatttcatcaac
aaggaattgattctcttctcaaattcagacaatgaaagatctataccatctcttgttgat
ggctttaaaccaggccaacgaaaagttttatttacctgtttcaagagaaacgataaacgt
gaagtaaaagttgcccagttggctggatctgttgctgagatgtctgcttatcatcatgga
gaacaagcattgatgatgactattgtgaatttggctcagaactttgtgggaagtaacaac
attaacttgcttcagcctattggtcagtttggaactcggcttcatggtggcaaagatgct
gcaagccctcgttatattttcacaatgttaagctctttagcaaggcggctttttcctcct
gtggatgataacctgcttaaattcctgtatgatgataatcaacgtgtagagcctgagtgg
tatattcccataatccccatggttttaataaatggtgctgagggcattggtactggatgg
gcttgtaaactacccaactatgatgctagggaaattgtgaacaatgtcagacgaatgcta
gatggcttggatcctcatcccatgcttccaaactacaaaaactttaaaggaacgatccaa
gaacttggtcaaaaccaatatgcagtcagtggtgaaatatttgtggtggatagaaacaca
gtagagattacagagcttccagttagaacttggacacaggtatacaaagaacaagtttta
gaacctatgctaaatggaacagataaaacaccagcattaatttctgattataaagaatat
catactgacacaactgtgaaatttgtggtgaaaatgactgaagagaaactagcacaagca
gaagctgctggactgcacaaagtttttaagcttcaaactactcttacttgtaattccatg
gtactctttgatcatatgggctgtctgaagaagtatgaaactgtacaggacattttgaaa
gaattctttgatttacgactaagttattatggtttacgtagggagtggcttgtagggatg
ttgggagcagaatctgcaaagcttaacaatcaagctcgtttcattttagagaagatacaa
ggaaaaattactatagagaataggtcaaagaaagatttgattcaaatgttagtccagaga
ggttatgaatctgacccagtgaaagcctggaaagaagcacaagaaaaggcaacagaagag
gaagaaacacaaaaccagcatgatgatagttcctctgattcaggaactccttcaggccct
gattttaattatattttaaatatgtctctgtggtctcttactaaagaaaaagttgaagaa
ttgattaaacagagagatgcgaaaggacgagaggtcaatgatcttaaaagaaaatctcct
tcagatctttggaaagaagatttagcagcatttgctgaagaactggataaagtggaagct
caagaacgagaagatattctggctggaatggctggaagaacaataaaaggtaaagttggc
aaacctaaggtgaagaaacttcagttggatgagactatgccctcaccttacgggaggaga
atcgttcccgaaatcactgctatgaaggcagatgccagcaaaaagttgttgaagaagaaa
aagggcgatcttgataccacaacagtaaaagtggaatttgatgaagaattcagtggaaca
ccagtagaaggtacaggcgaagaggcattgatacagtcagtgcctgtaaataaaggtccc
aaacccaaaagggagaagaaggagcctggtaccagggtgagaaaaacacctacatcatct
ggtaaatctagtgcaaagaaagtgaagaaacggaatccttggtcagatgatgaatccaag
tcagaaagcgacttggaagaaacagaacctgtggttattccaagagattctttgcttagg
agagcggctgctgaaaggcctaagtacacgtttgatttctcagaagaagaggatgatgat
gctgatgatgatgatgacaataatgatttagaggaattaaaagttaaagcatctcccata
acaaatgatggggaagatgagtttgttccttcagatggcctagataaagatgaatataca
ttttcaccaggcaaatctaaaactattccagaaaaatcttcgcatgataaaaaaagtcag
gattttgggaatcttttctcatttccttcatactctcagaagtcagaagatgattcagct
aaatttgacagtaatgaagaagattctgcttctgttttttcaccgtcatttggtctgaaa
caaacagataaagtaccaagtaaaacagtagctgctaaaaaaggaaaaccatcttcagat
acaacccctaagcccaagagaactcccaaacagaagaaagtagagactataaactctgac
tcagattcagaatttggcattccaaagaagactacaacaccaaaaggtaaaggccgaggg
gcaaagaaaaggaaagcatctggctctgaaaatgaaggtgattataaccctggcaggaaa
acatccaaaacaccaagcaagaaaccgaagaaaacatcttttgatcaggattcggatgtg
gacatcttcccatcagacttcacttctgaaccaccttctctgccacggacgggtcgggct
aggaaagaagtaaaatattttgcagagtctgatgaagaagaagatgttgattttgcaatg
tttaattaa

KEGG   Pteropus alecto (black flying fox): 102879885
Entry
102879885         CDS       T02993                                 

Gene name
TOP2A
Definition
(RefSeq) DNA topoisomerase 2-alpha
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:pale00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102879885 (TOP2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pale03032]
    102879885 (TOP2A)
   03036 Chromosome and associated proteins [BR:pale03036]
    102879885 (TOP2A)
Enzymes [BR:pale01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     102879885 (TOP2A)
DNA replication proteins [BR:pale03032]
 Eukaryotic type
  DNA Topoisomerases
   102879885 (TOP2A)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    102879885 (TOP2A)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102879885 (TOP2A)
SSDB
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB DTHCT HATPase_c Toprim
Other DBs
NCBI-GeneID: 102879885
NCBI-ProteinID: XP_006924738
LinkDB
Position
Unknown
AA seq 1531 aa
MEVSPLQPVNENMQINKTKKNEDAKKRLSIERIYQKKTQLEHILLRPDTYIGSVELVTQQ
MWVYDEDIGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWN
NGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE
TASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMV
RRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKVDETGNPLKIIHEQVNHRWEVC
LTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHM
WIFVNALIENPTFDSQTKENMTLQVKNFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQ
IQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDR
YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMT
DQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKS
STPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDD
RKEWLTHFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVD
GLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNN
LNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPQDDHTLKFLYDDNQRVEPEW
YIPIIPMVLINGAEGIGTGWSCKIPNFDIREVVNNIRLLMDGEEPLPMLPSYKNFKGTIE
ELAPNQYVISGEVAILNSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPPLITDYREY
HTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTALDILR
DFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQR
GYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTGPTFNYLLDMPLWYLTKEKKD
ELCKLRKEKEQELETLKKKSPSDLWKEDLAAFIEELETVEAKEKQDEQVGLPGKGGKGKG
KKTQMAEVLPSPSGKRVIPRVTIEMKAEAEKKIKRKIKNENSEGTPQENGMEPESLKQRL
EKKLKKEPGTKTKKQTTLPFKPVKKGKKRNPWSDSESDASSNESDFDVPPREIEPRRAAT
KTKFTVDLDSDEDFSDFDQETQDEDFVPSDASPVKTRTSPKRANKELKPQKSTTSVTDFD
ADDAKDDVPLSPSSPAADFPAETEIVNPVSKKNVTVKKTAAKSQSSTSTTGAKKRAAPKR
TKKDPGVNSDAPQKPDPPKTKTRRKRKPSTSDDSDSNFEKMISKAVTSKKSKGESDDFHL
DLDSAVAPRVKSGRAKKPIKYLEESDEDDLF
NT seq 4596 nt   +upstreamnt  +downstreamnt
atggaggtgtcaccactgcagcctgtaaatgaaaatatgcaaatcaacaaaacaaagaaa
aatgaagatgctaagaaaagactgtctattgaaagaatctatcaaaagaaaacacagttg
gaacacattttgctccgtccagacacttacattggctctgtggaattagtgacccagcaa
atgtgggtttacgatgaagatattggcattaactatagggaagtcactttcgttcctggt
ttatacaaaatctttgatgagattctagtcaatgctgcagacaacaaacaaagagaccca
aaaatgtcttgtattagagtcacaattgacccggaaaacaatttaattagtatatggaat
aatggaaaaggtattcctgttgttgaacacaaagttgagaagatgtatgtcccagctctc
atctttggacagctcctaacttctagtaactatgatgatgatgaaaagaaagtaacaggt
ggtcgaaatggctatggagccaaattgtgtaacatatttagtaccaaatttactgtggaa
acagccagtagagaatacaagaaaatgttcaaacagacgtggatggataacatggggaga
gctggtgagatggaactcaagccctttaatggagaagattatacatgtattaccttccag
cctgatttgtctaagtttaaaatgcagagccttgacaaagatattgttgcactgatggtt
agaagagcatatgatattgctggatccactaaagatgtcaaagtctttctcaatggaaat
aagttgccagtgaaaggattccgtagctatgtggatatgtatttgaaggataaagtagat
gaaactggcaatccattgaaaatcatccacgaacaagtaaaccacaggtgggaagtgtgt
ttaacaatgagtgaaaaaggctttcagcaaattagctttgtcaacagcattgctacttcc
aagggtggcagacatgttgattatgtagctgatcagattgtgactaaacttgttgatgtt
gtgaagaagaagaacaagggcggtgttgcagtaaaagcacatcaggtgaaaaatcacatg
tggatttttgtgaatgccttaattgaaaacccaacctttgactctcagacaaaagaaaac
atgactttacaagtcaagaactttggatcaacatgccaactaagtgaaaaattcatcaaa
gctgcaattggctgtggtattgtagaaagcatactaaactgggtgaagtttaaggctcaa
atccagttaaacaagaagtgttccgctgtgaaacataacagaatcaagggtattcccaaa
cttgatgatgccaatgatgcagggggccgaaactccactgagtgtacacttatcctgacc
gagggagactcagctaaaactttggctgtttcaggccttggtgtggttgggagagataga
tatggggttttccctcttagaggaaaaatactcaatgttcgagaagcttctcataaacag
ataatggaaaatgccgaaattaacaatatcatcaagattgtgggtcttcaatacaagaaa
aactatgaagatgaagattcattgaagactcttcgttatgggaagataatgattatgaca
gatcaggaccaagacggttcccatatcaaaggcttgctgattaattttatccatcacaac
tggccctctcttctgcgacatcgttttctggaggaatttatcactcccattgtaaaggtg
tctaaaaacaagcaagaaatggcattctatagtctgcctgaatttgaagaatggaagagt
tctacaccaaatcataaaaaatggaaagtcaagtattacaaaggtttgggcaccagcaca
tcaaaagaagctaaagaatactttgcagatatgaaaagacatcgtatccagttcaaatat
tctggtcctgaagatgatgctgcaatcagcctggcctttagcaaaaaacagatagatgat
cgaaaggaatggttaactcatttcatggaggatagaagacaacgaaagttacttggcctt
cctgaggattacttgtatgggcaaacaaccacatatctgacctacaatgacttcataaac
aaggaactaatcctgttctcaaattctgataacgagagatctatcccgtctatggtggat
ggtttgaaaccaggtcagagaaaggttttgtttacgtgtttcaaacggaatgacaagcga
gaggtgaaggtagcccagttagctgggtcagtggctgagatgtcctcttatcatcatggt
gagatgtcactaatgatgaccattatcaatttggctcagaattttgtgggtagcaataat
ctgaacctcttgcagcccattggtcagtttggtaccaggctgcatggtggcaaggattct
gctagtcctcgatacatcttcacaatgctcagccctttggctcggttgttatttccacca
caagatgatcacacattaaagttcttatatgatgacaaccagcgtgtggagcctgagtgg
tacattcctattatacccatggtgctgataaatggtgctgaaggaattggtactgggtgg
tcctgcaaaattcccaactttgatattcgtgaagtcgtgaataatatcaggcttttgatg
gatggagaagaacctttgccaatgcttcccagttacaagaacttcaagggtactattgaa
gagctggctccaaatcagtatgtgattagtggtgaagtggctattcttaattccacaacc
attgaaatctcagagcttcccatcagaacatggacccagacatataaagaacaggttctg
gaaccaatgttgaacggcacagagaagacacctcctcttataacagattatagggaatac
catacagataccactgtgaagtttgttgtgaaaatgactgaagaaaaactggcagaggcc
gagagagtgggactacacaaagtcttcaaactccaaactagtctcacatgcaactctatg
gtgctttttgaccacgtaggctgtttaaagaaatatgacacagcgttggatattctaaga
gacttctttgaactcaggcttaaatattatggattaagaaaagaatggcttctaggaatg
cttggcgctgaatctgctaaactgaacaatcaggctcgcttcatcttagagaaaatagat
ggcaaaataatcattgaaaataagcctaagaaagaattgattaaagttttgattcagaga
ggatatgattcggatcctgtgaaagcttggaaagaagcccagcaaaaggttccagatgaa
gaagaaaacgaagagagcgataatgaaaaggaaactgaaaagagtgactctgtaactgga
ccaaccttcaactaccttcttgatatgcctctttggtatcttaccaaggaaaagaaagat
gaactatgcaaattaagaaaggaaaaagaacaagagctagaaacattaaagaaaaagagt
ccatcagatttgtggaaagaagacttggctgcttttattgaagagctggagactgttgaa
gccaaggaaaaacaagatgaacaagtaggacttcctgggaaaggggggaaaggaaaaggg
aaaaaaacacaaatggctgaagttttgccttcaccaagtggaaaaagagtcattccccga
gttaccatagagatgaaagcagaggcagaaaagaaaattaaaaggaaaattaagaatgaa
aattctgaaggaactcctcaagagaatggtatggaacccgaaagcctaaaacaaagatta
gagaagaaactgaaaaaagaaccaggtaccaagacgaagaaacaaactacattgccattt
aaaccagtcaaaaaaggaaagaagagaaacccctggtctgattcagaatcagatgcgagc
agtaacgaaagtgattttgatgtccctccacgagaaatagagccacggagagcagcaaca
aaaaccaaattcacagtggatttagattcagatgaagatttctcagattttgatcaagaa
actcaagatgaagattttgtgccatctgatgctagtccagttaagaccagaacttccccg
aaacgtgctaacaaagaactgaagccacagaagagcaccacgtcagtaacggactttgat
gctgatgatgccaaggacgatgttccactttctccaagttctcctgctgctgatttccca
gccgaaacagaaattgtaaaccctgtttctaaaaagaacgtgacagtgaagaagacggca
gcaaaaagtcagtcttccacctcgactacaggtgccaaaaaaagggctgcaccaaaaaga
accaaaaaggatccaggcgtgaattctgatgcccctcaaaagcctgatccccccaaaacc
aagactcgccgcaaaagaaagccatccacttctgatgattccgactctaactttgagaaa
atgatttctaaagcagtcacaagcaagaaatccaagggggagagtgatgacttccacctg
gacttagactcagctgtggctcctcgtgtaaaatctgggcgggcaaagaagccgataaag
taccttgaagaatcagatgaagatgatctgttttaa

DBGET integrated database retrieval system