KEGG   Pteropus alecto (black flying fox): 102879561
Entry
102879561         CDS       T02993                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6 isoform X5
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04010  MAPK signaling pathway
pale04060  Cytokine-cytokine receptor interaction
pale04115  p53 signaling pathway
pale04210  Apoptosis
pale04217  Necroptosis
pale04650  Natural killer cell mediated cytotoxicity
pale04668  TNF signaling pathway
pale04932  Non-alcoholic fatty liver disease
pale04940  Type I diabetes mellitus
pale05010  Alzheimer disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05142  Chagas disease
pale05143  African trypanosomiasis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05320  Autoimmune thyroid disease
pale05330  Allograft rejection
pale05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102879561 (FAS)
   04668 TNF signaling pathway
    102879561 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102879561 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102879561 (FAS)
   04217 Necroptosis
    102879561 (FAS)
   04115 p53 signaling pathway
    102879561 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102879561 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102879561 (FAS)
   05205 Proteoglycans in cancer
    102879561 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102879561 (FAS)
   05330 Allograft rejection
    102879561 (FAS)
   05332 Graft-versus-host disease
    102879561 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102879561 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102879561 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102879561 (FAS)
   04932 Non-alcoholic fatty liver disease
    102879561 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102879561 (FAS)
   05161 Hepatitis B
    102879561 (FAS)
   05160 Hepatitis C
    102879561 (FAS)
   05164 Influenza A
    102879561 (FAS)
   05162 Measles
    102879561 (FAS)
   05168 Herpes simplex virus 1 infection
    102879561 (FAS)
   05163 Human cytomegalovirus infection
    102879561 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102879561 (FAS)
   05169 Epstein-Barr virus infection
    102879561 (FAS)
   05165 Human papillomavirus infection
    102879561 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102879561 (FAS)
   05143 African trypanosomiasis
    102879561 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102879561 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102879561 (FAS)
   04090 CD molecules [BR:pale04090]
    102879561 (FAS)
Cytokine receptors [BR:pale04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102879561 (FAS)
CD molecules [BR:pale04090]
 Proteins
  102879561 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6 Stn1_C DciA
Other DBs
NCBI-GeneID: 102879561
NCBI-ProteinID: XP_006926030
LinkDB
Position
Unknown
AA seq 335 aa
MTGLGVLLPLIVIFIAGPLSKGGNTQVTSINSEVLESSHNITERESGCPKGLHRDGKFCC
HLCPPGTRKDTGCTTDEGKPDCVPCPEGEEYTDRKHYSSKCRRCGICDGEQGLEVEKNCT
QIQNTQCRCKSNFFCDIPPCEHCNPCDTCEHGISENCTPTNNTKCKVFQSTGSSRGYLWF
LIFIPISALAGSVIWWRKRRGRNNVGHNESRASIPRIVPMNFSDIDLSKYITTIAEQMKI
NQVREFVRKNGINEAKIDEIKNDNLQDTAEQKVQLLRNWYQLHGKKDAYCTLIQSLKKAN
LYVLAEKIEDIVQKDMVSEHENANIRNENESQSLV
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgaccgggctcggggttctcctgcctctgatagttatctttattgctggaccattatct
aaaggtggtaatacccaagtgaccagtatcaactctgaggtgttggaatcaagtcataac
attactgaacgggagtctgggtgcccgaaaggcctacatcgtgatggtaaattctgctgt
cacctatgtcctcctggcacacggaaagatactggttgtacaactgatgagggcaaacca
gactgtgttccctgtccagaaggagaggagtacacagacaggaaacattattcttctaaa
tgcagaagatgtggaatttgtgatggagaacaaggcttagaagtggaaaaaaactgtacc
cagatccagaatacccagtgcagatgtaaatcaaactttttttgtgacattcctccatgc
gagcactgtaatccttgcgatacgtgtgaacatggaatcagtgagaattgcacaccaacc
aacaacaccaaatgtaaagtgttccaatctacaggatccagccgtgggtatctgtggttc
ctcatcttcatcccgatttcagcacttgcaggatcagtaatttggtggcggaaaagacga
ggcaggaataatgttggtcacaatgaatctagagcttcaattcctagaatagttccaatg
aatttctcagacatcgacttgagtaaatatattaccactattgctgagcaaatgaaaata
aatcaagttagagaattcgttcggaagaatggtatcaatgaagcaaaaatagatgaaatc
aagaatgacaatctccaagatacagctgaacagaaggtccagctgctccgtaattggtat
caacttcacgggaagaaagatgcatattgcactttgattcaaagtctcaagaaagccaat
ctttatgtccttgcagagaaaattgaagatatagtccaaaaggacatggttagtgaacat
gaaaatgctaacatcagaaatgaaaatgaaagccaaagcttggtctaa

DBGET integrated database retrieval system