KEGG   Pteropus alecto (black flying fox): 102879667
Entry
102879667         CDS       T02993                                 

Gene name
KL
Definition
(RefSeq) klotho
  KO
K14756  klotho [EC:3.2.1.31]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00040  Pentose and glucuronate interconversions
pale00053  Ascorbate and aldarate metabolism
pale01100  Metabolic pathways
pale04211  Longevity regulating pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale04961  Endocrine and other factor-regulated calcium reabsorption
Module
pale_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102879667 (KL)
   00053 Ascorbate and aldarate metabolism
    102879667 (KL)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    102879667 (KL)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102879667 (KL)
  09149 Aging
   04211 Longevity regulating pathway
    102879667 (KL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102879667 (KL)
   04147 Exosome [BR:pale04147]
    102879667 (KL)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     102879667 (KL)
Transporters [BR:pale02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   102879667 (KL)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102879667 (KL)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 102879667
NCBI-ProteinID: XP_024905278
LinkDB
Position
Unknown
AA seq 928 aa
ANGSAGAQPRSPAPPEDPPGAGLPSGFPPQSPPATGDVASDSYNNVLRDTEGLRELGVTH
YRFSISWARVLPNGSAGAPNREGLRYYGHLLQRLRELGVEPVVTLYHWDLPQRLQDAYGG
WANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGVRGSARLGYL
VAHNLLLAHAKTWHLYNTSFRPTQGGQVSISLSSHWVSPRRMTNHSIRECQKSLDFVLGW
FAKPIFIDGDYPESMKNNLSSLLPTFTESEKKFIKGTADFFALSFGPILSFQLLDPRMKF
RQLESSSLRQLLSWIDLEYNHPQIFIVENGWFVSETTKTDDAKYMYYLKRFIMETLKAIR
LDGVDVIGYTVWSLMDGFEWHRGYSIRRGLFYVDFLSQDKKLLPKSSALFYQQLIEKNGF
PPLPENQPLEGTFPCAFAWGIVDNYIQVDTTLSQFTDPSVYLWDVHRSKGLIKVQGLVTQ
KRKSYCADFAAIRPLVSLLQETHATHFHFALDWALILPLGNRSQVNHTALHYYCCVASEL
VRANITPVVALWRPAALRPGLPAPLAAHGAWENPHIAPAFAEYAGLCFKALGPHVKLWVT
ASEPYTRNLTYRAGHNLLKAHALAWHLYDQQFRRSQRGRISIALQADWVEPACPLSPRDK
EVAERVLEFDIGWLAEPIFGSGDYPRVMRDWLTQRNDYLLPYFTEDEKRLIRGSFDFLAL
SHYTTILVGWEKEDPGKYNDYLEVQEMTDSTWLSSPGQVAVVPWGLRKVLNWLKLKYGDL
PTYIISNGIDDDLHAAQDALRVYYMHNYVNEALKAYVLDGIKLCGYFAYSFNDRTAPKFG
LYRYAANQFEPKPSMKHYRKIIDDNGFPGPETLGGFCPEEFTLCADCSFLHTRKSLLAFI
AFLCLAFIISLSLIFYYSKKGRRSYKRS
NT seq 2787 nt   +upstreamnt  +downstreamnt
gccaatggcagcgcgggcgcccaaccgcgaagccccgctcccccggaggaccccccgggg
gccggcctgccgtcgggttttccgccgcagtccccgcccgcgactggggacgtggccagc
gacagctacaacaacgtcttgcgcgacaccgaggggctgcgcgagctcggggtcacccac
taccgcttctccatctcgtgggcgcgggtgctccccaatggcagcgcgggcgcccccaac
cgcgaagggctgcgctactacggacacctgctgcagcggctgcgcgagctgggtgtggag
cccgtggtcaccctgtaccactgggacctgccccagcgcctgcaggacgcctacggcggc
tgggccaaccgcgccttggccgaccatttcagggactacgccgagctctgcttccgccac
ttcggcggccaggtcaagtactggatcaccatcgacaacccctacgtggtggcctggcac
ggctacgccaccgggcgcctggcccccggcgtccggggcagcgcgcggctcgggtacctg
gtggcgcacaatctcctcctggctcatgccaaaacctggcatctctacaatacttctttc
cgtccaactcaggggggccaggtgtccatctccctaagttcccactgggtcagtcctcga
agaatgacgaaccacagcatcagagaatgtcagaaatctcttgactttgtactaggctgg
tttgccaaacccatattcattgatggtgactacccagagagcatgaagaataatctttca
tctcttttaccaacttttactgaatctgagaaaaagttcatcaagggaacagctgacttt
tttgctctttcttttggcccaatcttgagttttcaactactggaccctcgcatgaagttc
cgccaattagaatcttctagcctgaggcaactgctttcctggattgacctggaatataac
caccctcaaatatttattgtggaaaatggctggtttgtctcagagaccactaagacagat
gacgccaaatatatgtattacctcaaaagattcataatggaaaccttaaaagccatcagg
ctggatggggtggacgtcatcgggtacacggtgtggtctctcatggacggctttgagtgg
caccgaggctatagcatcaggcgcggactcttctacgtggactttctaagccaggataag
aagttgttgccgaagtcttcagccttgttctaccaacagctgatagagaaaaatggcttc
cctcctttacctgaaaatcaacccctagaagggacatttccctgtgcctttgcttgggga
attgttgacaactacattcaagtcgacaccactctgtctcagtttaccgacccgagcgtc
tacctgtgggacgtccaccgcagcaaggggctcattaaggtgcagggcctcgtgacccag
aagaggaaatcctactgcgccgacttcgctgccatcaggcctctggtctccctgctccag
gaaacgcacgcgacgcatttccacttcgccctggactgggccctgatcctcccgctgggc
aaccggtcccaggtgaaccacacggccctgcactactactgctgcgtggccagcgaactg
gtgcgggccaacatcaccccggtggtggccttgtggcgacccgcggccctgcgcccaggg
ctgcccgcgcccctggctgcgcacggcgcctgggagaacccccacatcgccccggctttc
gcagagtacgccgggctgtgctttaaagcgctcgggccccacgtcaagctctgggtgacg
gcgagcgagccttacactcggaacctcacctacagggccggccacaacctcctgaaggcg
cacgcgctggcctggcacctgtacgaccagcagttccggcgctcgcagagagggcgaatc
tccatcgccttgcaggccgactgggtggaacccgcctgccctctctccccgagggacaaa
gaggtggccgagagagttttggaatttgacatcggctggctggccgaacccattttcggc
tctggggattatccacgtgtgatgagggactggctgacacaaagaaacgattacctgcta
ccttatttcactgaggatgagaaaaggctaatccgcggttcctttgactttctggcttta
agccattacaccaccatccttgtaggctgggagaaagaagatccaggaaaatacaatgat
tacctggaagtgcaagaaatgaccgacagcacctggcttagctccccgggtcaggtggca
gtagtgccctggggcttgcgcaaagtcctgaactggctgaagctcaagtacggagacctc
cccacgtacatcatctccaatggcatcgatgacgacctgcacgcagcccaagacgccttg
cgggtgtattatatgcacaattatgtaaatgaagctctgaaagcctatgtattggatggg
atcaaactttgtggttactttgcctattcgtttaatgatcgcacagctccgaaatttggc
ctctatcgttacgccgccaatcagtttgagcccaaaccatccatgaaacattacaggaaa
attattgacgacaacggcttcccgggtcccgagaccctgggagggttttgtccagaagaa
ttcaccctgtgtgccgactgcagttttcttcatacacgaaagtctttgctggccttcata
gcttttctctgtttagcttttattatttctctttctcttattttttactactctaagaaa
ggcaggagaagttacaaacggtcctga

DBGET integrated database retrieval system