KEGG   Pteropus alecto (black flying fox): 102879672
Entry
102879672         CDS       T02993                                 

Gene name
FHL1
Definition
(RefSeq) four and a half LIM domains protein 1 isoform X2
  KO
K14365  four and a half LIM domains protein 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102879672 (FHL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pale04990]
    102879672 (FHL1)
Domain-containing proteins not elsewhere classified [BR:pale04990]
 LIM domain-containing proteins
  FHL family proteins
   102879672 (FHL1)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 102879672
NCBI-ProteinID: XP_006917243
LinkDB
Position
Unknown
AA seq 323 aa
MAEKFDCHYCRDPLQGKKYVEKDGHHCCLKCFDKFCANTCVDCRKPIGADSKEVHYKNRY
WHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSLKCKGCFKQIVAGDQNVEYKGT
VWHKDCFTCSNCKQVIGTGSFFPKGEDFYCSTCHEAKFAKHCVKCNKAITSGGITYQDQP
WHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGKRTVSRVSHP
VSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLYRKNRSLAAPRGPGLVK
APVWWPMKDNPGTTTASTAKNAP
NT seq 972 nt   +upstreamnt  +downstreamnt
atggccgagaaatttgactgccactactgcagggatcccctgcaggggaagaagtacgtg
gaaaaggatggccaccactgctgcctgaagtgctttgacaagttctgcgccaacacctgt
gtcgactgccgcaagcctatcggtgcggactccaaggaggtgcactataagaatcgctac
tggcatgacacctgcttccgctgtgccaagtgccttcaccccttggccaatgagaccttt
gtggccaaggacaacaagatcctgtgcaacaagtgcaccacacgggaggactccctcaag
tgcaagggctgcttcaagcaaatcgtggcaggagatcagaacgtggagtacaaggggacc
gtctggcacaaagactgcttcacctgcagcaactgcaagcaagtcatcgggactggaagc
ttcttccctaagggggaagacttctactgctcaacttgccacgaggccaaatttgccaag
cattgcgtgaagtgcaacaaggccatcacatctggaggaatcacttaccaggatcagccc
tggcatgccgagtgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttc
accgctgtggaggaccagtattactgcgtggattgctacaagaactttgtggccaagaag
tgtgctggatgcaagaaccccatcactgggaaaaggactgtgtcaagagtgagccaccca
gtctctaaagctaggaagcccccagtgtgccacgggaaacgcttgcctctcaccctgttt
cccagcgccaacctccggggcaggcatccgggtggagagaggacttgtccctcgtgggtg
gtggttctttatagaaaaaatcgaagcttagcagctcctcgaggcccgggtttggtaaag
gctccagtgtggtggcctatgaaggacaatcctggcacgactactgcttccactgcaaaa
aatgctccatga

DBGET integrated database retrieval system