KEGG   Pteropus alecto (black flying fox): 102879824
Entry
102879824         CDS       T02993                                 

Gene name
EML4
Definition
(RefSeq) echinoderm microtubule-associated protein-like 4 isoform X1
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale05200  Pathways in cancer
pale05223  Non-small cell lung cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102879824 (EML4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102879824 (EML4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102879824 (EML4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pale04812]
    102879824 (EML4)
Cytoskeleton proteins [BR:pale04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     102879824 (EML4)
SSDB
Motif
Pfam: WD40 HELP Ribosomal_S7 SlyX
Other DBs
NCBI-GeneID: 102879824
NCBI-ProteinID: XP_006909706
LinkDB
Position
Unknown
AA seq 991 aa
MDGFAGSLDDSISAASTSDVQDRLSALELRVQQQEDEITVLKAALADVLRRLAISEDHVA
SVKKSVPNKGQPGIREAISMSCITNGSGANRKPSHTTSVSIARKETLSSAAKSGTEKKKE
KPQGQREKREESHSNDQSPQIRASPSPQPSSQPLQIHRQTQESKNSTPTKSIKRPTAEKS
HNSWENSDDSRNKLLKAVSTSKLISRVIKNTDKHKDVIINQAKMSTREKNSQEGEYVKMF
MRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWAYGYRGKDCRANVYLLPTGEIVYFIAS
VVVLFNYEERTQRHYLGHTDCVKCLAVHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSVS
LATLQIIGLGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKSKGAEIKTTNE
VVLAVEFHPTDANIIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFMGNGDV
LTGDSGGVILIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKD
RKVILWDHDLNPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFNDGFQIEVQG
HTDELWGLATHPFKDLLLTCAQDRQVCMWNSVEHRLEWTRLVDEPGHCADFHPSGTVVAI
GTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSVDGTFLAVGSHDNFIYLYVVSENGRK
YSRYGKCTGHSSYITHLDWSPDNKYIMSNSGDYEILYWDIPSGCKLIRNRSDCKDIDWTT
YTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHKY
SAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNEIVADTSLTKAPISSIE
NVMQSNTPTPPPSQPLNETAEEESRISNSPTLLENSLEQTMEPSEDHSEEQSEGGSEDLG
EPVYEEPSSEMREEQSETTLTEDQQDPSPLS
NT seq 2976 nt   +upstreamnt  +downstreamnt
atggacggtttcgccggcagcctcgatgatagtatatctgctgcaagtacttctgatgtt
caagatcgcctctcagctcttgagttacgagttcaacaacaagaggatgaaatcactgta
ctaaaggcagctttggctgatgttttgaggcgtcttgcaatctcagaagatcatgtcgcc
tcagtgaagaaatcagtcccaaataaaggccaaccaggcattcgagaagctatttccatg
tcctgtataaccaatggaagtggtgcgaacagaaaaccaagtcataccacatctgtctca
attgcaagaaaagaaactctttcatctgctgctaaaagtggtacagaaaaaaagaaagaa
aaaccacaaggacagagagaaaaaagagaggaatctcattctaatgatcaaagtccacaa
attcgagcatcaccttctccccagccctcttcacagcctctccaaatacacagacaaact
caagaaagcaagaattctactcccaccaaaagcataaaacgaccaacggctgaaaagtca
cataattcatgggaaaattcagatgatagtcgtaataaattattgaaagcagtttcaaca
tcaaaattaatatcaagagttataaaaaatacagacaagcataaagatgtcatcatcaat
caagcaaaaatgtcaacccgtgaaaaaaacagccaagaaggagaatatgttaaaatgttt
atgcgaggtcggccaattacaatgtttattccttctgatgttgacaactatgatgacatc
agaacagaactgcctcctgagaagctcaaactggagtgggcatatggttatcgaggaaag
gactgccgagctaatgtttaccttcttcctactggggaaatagtttatttcatagcatca
gtagtagtactgtttaattatgaggagagaactcaacgacactacctgggtcatacagac
tgtgtgaaatgccttgctgtacatcctgacaaaattaggattgcaactggacagatagct
ggagtggataaagatggaaggcctctgcaaccccatgtcagagtgtgggattcagttagt
ctagccacactgcaaattattggacttggaactttcgagcgtggagtaggatgccttgat
ttttcaaaagcagattcaggtgttcatttgtgtgttatcgatgactccaatgagcatatg
cttactgtgtgggattggcagaaaaaatcaaaaggtgcagaaataaagacaacaaatgaa
gttgttttggctgtggagttccatccaacagatgcaaatatcataataacatgtggtaaa
tctcatatttttttctggacctggagtggtaattcactaacaaggaaacagggaattttt
gggaaatatgaaaaaccgaaatttgtgcagtgtttagcatttatggggaatggagatgtt
cttactggagactcaggtggagtcatacttatatggagtaaaactactgtagaaccgaca
cctgggaaagggcctaaaggtgtttatcagatcagcaaacaaatcaaagctcatgatggc
agtgtgttcacactttgtcagatgagaaatgggatgttattaacaggaggaggaaaagac
agaaaagtaattctgtgggatcatgatctgaaccctgaaagagaaattgaggttcctgat
cagtatggaacaatcagagctgtagcggaaggaaaggcagatcaatttttagtgggcaca
tcacgaaactttattttacggggaacttttaatgatggcttccaaatagaagtacagggt
catacagatgagctttggggtcttgccacacatcccttcaaagatttgctcttgacatgt
gctcaggacagacaagtgtgcatgtggaactcagtggagcacaggctggaatggaccagg
ctcgtagatgaaccaggacactgtgcagattttcatccaagtggcacagtggtggccata
ggaacgcactcaggcaggtggtttgttctggatgcagaaaccagagatctagtttctatc
cacacagatgggaatgaacagctctctgtgatgcgctactcagtagatggcaccttcttg
gctgtaggatctcacgacaactttatttacctctatgtagtctcagaaaatggaagaaaa
tatagcagatatggaaagtgcactggacattccagttatatcacacatcttgactggtct
ccagataacaagtatataatgtctaactcgggagactacgaaatattgtactgggacatt
ccaagtggctgcaaactaatcaggaatcgatctgattgtaaggacatcgattggacgaca
tacacctgtgtactaggctttcaagtctttggtgtctggccagaaggatccgatggaaca
gatatcaatgcgctagtgcgatcccataataggaaggtgatagctgttgctgatgacttt
tgcaaagtccatctgtttcagtatccgtgctccaaagcaaaggctccgagtcacaagtac
agtgcccacagcagccatgtcaccaatgtcagttttactcataatgacagtcacctgatt
tcaactggtggaaaagacatgagcattattcagtggaaacttgtggaaaagttatctttg
cctcaaaacgagattgtagcagatactagtctaaccaaagcccccatctcttccattgaa
aacgtcatgcaatctaatacgcccacaccgcctccttctcagccattaaatgagacagct
gaagaagaaagcagaataagcaactctcctacacttctggagaacagcctggaacagact
atggagcccagcgaagatcacagtgaggagcagagtgaagggggcagtgaagacctcggt
gagcctgtttatgaagagccatccagtgagatgagggaggagcagagtgaaaccactctt
accgaggaccagcaagacccttcacccctatcttaa

KEGG   Pteropus alecto (black flying fox): 102884662
Entry
102884662         CDS       T02993                                 

Gene name
ALK
Definition
(RefSeq) ALK tyrosine kinase receptor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale05200  Pathways in cancer
pale05223  Non-small cell lung cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102884662 (ALK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102884662 (ALK)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102884662 (ALK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102884662 (ALK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pale04090]
    102884662 (ALK)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102884662 (ALK)
Protein kinases [BR:pale01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   102884662 (ALK)
CD molecules [BR:pale04090]
 Proteins
  102884662 (ALK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr MAM Pkinase Gly_rich Ldl_recept_a Nup96 FXa_inhibition
Other DBs
NCBI-GeneID: 102884662
NCBI-ProteinID: XP_015443633
LinkDB
Position
Unknown
AA seq 1635 aa
MGAIGLLWLLLPLLSVAASSSGTRTRTGTGSGQRVDLPAIGPVLQPREPLSYSRLQRKSL
AVDFVVPSXXXXXXXXXXXXXXXXXXXXRVYARELLLPPPSLSPEARGSLALDCAPLLRL
VGPPPGVSWTAGASSPAPAQTLSRVLKGGSIRKLRRAKQLVLELGEEAILEGCIGPPEEA
TAGLLQFNLTELFSWWIHHGEGRLRIRLMPEKKPSEVGREGRLSAAIRASQPRLLFQIFG
SGHSSLESPTDLPSLPPDSFAWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLH
DLGNQSWSWRRVPSEEASKMDLLDGPEAEHSKEIPRGSFLLLNTSANSKHTILSPWMRSS
SEHCRLAVSVHRHLQPSGKYVAHLLPHNEAGREILLVPTPGKHGWTVLEGRIGRPENPFR
VALEYISSGNRSLSAVDFFALKNCSEGTSLGSKMALQSSFTCWNGTVLQLGQACDFHRDC
AQGEDEGQLCSKLPAGFYCNFEDGFCGWTQGTLSPHTPRWQVKTLKEARFQDHQGQALLL
STTEVPTSKSATVTSATFPAPMKNSPCELRMSWLVRGVLRGNVSLVLVENKTGKEQSRMV
WHVATSEGLSLWQWTVLPLLDVADRFWLQIVAWWGQGSRATVAFDNISISLDCYLTISGE
DKMPQNTAPKSRNLFERSPNKEVKLWENTPRETPIFDPTVHWLFTTCGASGPHGPTQAQC
NNAYRNSNLSVVVGSEGPLKGIQTWKVPATDTYSISGYGAAGGKGGRNTMMRSHGVSVLG
IFNLEKDDTLYILVGQQGEDACPSTNRLIQKVCIGENNVIEEEIRMNRSVHEWAGGGGGG
GGATYVFKMKDGVPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGG
GWNDNTSLLWSGKSLLEGATGGRSFPQAMKKWGWETRGGFGGGGVRCSSGGGGGGYIGGN
AASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPES
HKVICFCDHGTVLAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALILAFSGIMIVYRR
KHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRRNITLLRG
LGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVR
CIGVSLQALPRFILLELMAGGDLKSFLRETRPRPNQPSSLAMLDLLHVARDIACGCQYLE
ENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAF
MEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRI
MTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLMEEEEKVPMRPKCPEGI
PPLLVSPPPTKRETGPDPAAPPPPPSAPSGKAVKKATAAEVPVRVTRGPAVEGGHINMAF
AQSNPPSELHKVQGSRNKPTSLWNPTYGSWFTEKPTKKNHPPAKKGQHERGNVGREGSCI
VPPNIATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEATAAAG
AGHYEDTVLKNQPGP
NT seq 4908 nt   +upstreamnt  +downstreamnt
atgggagccatagggctcctatggctgctgctcccactgctttcagtggcagcctcgagc
tccgggaccaggacccggaccgggaccgggtccggccagcgcgtggacttaccggccata
gggccagtgctgcagccccgggagccgcttagctactcgcgtctgcagaggaagagcctg
gcggtggacttcgtggtgccctcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnncgtgtctatgcccgggagctgctgctgccgccgccg
tccctctcgccggaggcgcgtggctctctagctctagattgtgccccattgcttaggctg
gtggggccaccacccggggtctcctggacagcaggcgctagctctcctgccccggcacag
acgctgtccagggtgctgaagggcggctccattcgcaagctccggcgcgccaaacagctg
gtgctggagctgggagaggaggcgatcctcgaaggttgcatcgggcccccagaggaggcg
actgcggggttgctccagttcaacctcaccgagctgtttagctggtggattcaccacggt
gaagggcgactgaggatccgcttgatgcccgagaagaagccatcggaagtaggcagagag
ggaaggctgtccgcggcaatccgtgcctcccaaccccgccttctcttccagatcttcggg
tcgggtcacagctccttagagtcaccaacagatttgccttctcttcctcctgattctttt
gcatggaatctgacctggataatgaaagattcctttcctttcctgtctcatcgcagccga
tatggtctggagtgtagctttgacttcccctgtgagctggagtattcccctccactgcat
gaccttggaaaccagagctggtcctggcgccgtgtcccctccgaggaggcctccaagatg
gacctgttggatgggcctgaggcagagcattccaaggagatacccagaggttccttcctc
ctcctcaacacctcagcaaactccaagcacaccatcttgagcccgtggatgaggagcagc
agcgagcactgcaggcttgccgtctcggtgcacaggcacctgcagccctctgggaagtac
gtcgcccatctgctgccccacaatgaggctggaagagagatcctcctggtacccactccg
gggaagcatgggtggacagtgctagagggaagaattgggcgcccagagaacccgtttcga
gtggccttggaatacatctcaagtggaaaccgaagcttatctgcagtggacttctttgcc
ctgaagaactgcagtgaaggaacatccctgggatccaagatggccttgcagagttccttc
acttgctggaacgggacagtcctccagctcgggcaggcctgcgacttccaccgggactgc
gcccagggagaagacgagggccagctgtgcagtaaactccctgctggcttttactgcaat
ttcgaggatggcttctgtggctggacccaaggcacactctcgccccacacgccccggtgg
caggtcaagacgctaaaggaggcccggttccaggaccatcaaggccaggccctgttgctc
agcaccaccgaggtccccacttccaaaagtgctacggtgaccagtgctacgtttcctgca
ccgatgaaaaactctccatgtgagcttcgaatgtcctggctcgtccgtggagtcctgcgg
ggcaacgtctccttggtgctcgtggagaacaagaccggaaaggaacaaagcaggatggtc
tggcacgtagccaccagtgaaggcttgagcctgtggcagtggacagtgctgcccctcctc
gatgtggccgacaggttctggctgcagattgtcgcgtggtggggacaaggatccagagcc
accgtggcttttgacaatatctccatcagcctggactgctacctcaccatcagtggggag
gacaagatgccacagaacacagcacccaaatcgagaaatctgtttgagagaagcccaaac
aaggaggtgaaactctgggaaaatacaccaagggagacccccatctttgaccctacagtt
cactggctgtttaccacgtgtggggctagtgggcctcacggccccacgcaggcccagtgc
aacaacgcctaccggaattccaacctgagcgtggtggtggggagcgagggccccctgaag
ggcatccagacctggaaggtgccagccaccgacacctacagcatctcgggctacggagct
gctggtgggaaaggcgggcgaaacaccatgatgcggtcccacggcgtgtctgtgctgggc
atcttcaacctggagaaggacgacacgctgtacatcctggtcgggcagcagggggaagac
gcctgccccagcacgaaccgattgatccagaaagtctgcattggcgagaacaacgtgata
gaagaagagatccgcatgaacagaagtgtgcatgagtgggcaggagggggcggaggcggg
ggcggagccacctacgtgtttaagatgaaagatggcgtgcccgtgcccctgatcatcgcg
gccggtggtggtggccgggcctatggggccaagacggacacgttccaccccgagagactg
gagaataactcctcggttctagggctcaacggcaattccggagccgcaggtggtggaggt
ggctggaatgataacacttccttgctctggtctggaaaatctttgctggagggtgccacc
ggaggacgttccttcccccaggccatgaagaagtgggggtgggagacaagagggggtttc
ggagggggtggggtgcggtgctcctcaggtggaggaggcggaggatatataggcggcaat
gcagcctcaaataatgaccccgagatggacggggaggatggggtgtccttcatcagtcca
ctgggcatcctgtacaccccggctttaaaagtgatggaaggccatggggaagtgaatatt
aagcattacctgaactgcagccactgtgaggtagatgagtgtcacatggaccctgagagc
cacaaggtcatctgcttctgtgaccacgggacagtgctggctgaggacggtgtctcctgc
atcgtgtcacccaccccagaaccccacctgccactctctctgatcctctccgtcgtgacc
tctgctctcgtggccgccctcatcctggcattctctggcatcatgatcgtgtaccggcgg
aagcaccaggagctgcaagccatgcagatggaactgcagagtcctgagtacaagctgagc
aagctccgcacctcgaccatcatgactgactacaaccccaactactgcttcgccggcaag
acctcctccatcagtgacctgaaggaggtgccacggagaaacatcaccctcctccggggt
ctgggccatggtgcatttggggaggtctacgaaggtcaggtgtctggaatgcccaacgac
ccaagccccttgcaagtggctgtaaagacactgcctgaagtgtgttccgaacaggacgaa
ctggatttcctcatggaagccctgatcatcagcaaattcaaccaccagaacatcgtgcgc
tgtattggagtgagtttgcaagccctgccccgatttatcctgctggagctcatggcggga
ggagacctcaagtctttcctccgggagacccgccctcgcccgaatcagccctcctccctg
gccatgctggaccttctgcacgtggctcgggacattgcctgtggctgccagtacttagag
gaaaaccatttcatccaccgggacattgccgccaggaactgcctcttgacctgtccaggc
cctggaagagtagccaagattggggactttggaatggcccgagacatctacagagcgagc
tactaccgaaagggaggctgtgcaatgctgccagtgaaatggatgccgccagaggccttc
atggagggaatatttacttctaaaacagacacatggtcctttggagtgctgctgtgggaa
atattttctcttggatatatgccataccccagcaagagcaatcaggaagttctggagttc
gtcaccagcggaggacggatggacccacctaagaactgccctgggcctgtatacaggata
atgacccagtgctggcaacatcagcctgaagacagacccaacttcgccataattttggag
aggatcgaatactgcacccaggatccagatgtgatcaacaccgctttgccaatagaatat
ggcccactcatggaagaggaagagaaagtgcccatgaggcccaaatgccctgagggaatt
cctcctctccttgtctcccctccccccacaaaacgggagacggggccagatccagctgcc
ccgccacccccgccttccgctccctctggcaaagctgtgaagaaggcaacagccgcagaa
gtccctgtccgggtcactagaggcccagccgtggaagggggacacattaacatggcattc
gctcagtccaacccaccatcggagctgcacaaagtccagggatccagaaacaaaccaacc
agcctatggaacccaacttatggctcatggtttacagagaaacccaccaaaaagaaccat
cctccggcaaagaagggacaacatgagagggggaatgtggggcgtgaaggaagctgtatc
gtcccacctaacattgcgactggcagactcccaggtgcctctctgctcctggagccatct
tcactgactgccaacatgaaggaagtgcctctgttcaggctgcgtcacttcccgtgtgga
aacgtcaactatggctaccagcagcagggcttaccgttagaggccaccgcagccgccgga
gctggtcattatgaggacaccgttctgaaaaaccagcctgggccctga

DBGET integrated database retrieval system