KEGG   Pteropus alecto (black flying fox): 102879869
Entry
102879869         CDS       T02993                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: aldehyde oxidase 4-like
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00280  Valine, leucine and isoleucine degradation
pale00350  Tyrosine metabolism
pale00380  Tryptophan metabolism
pale00750  Vitamin B6 metabolism
pale00760  Nicotinate and nicotinamide metabolism
pale00830  Retinol metabolism
pale00982  Drug metabolism - cytochrome P450
pale01100  Metabolic pathways
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102879869
   00350 Tyrosine metabolism
    102879869
   00380 Tryptophan metabolism
    102879869
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    102879869
   00760 Nicotinate and nicotinamide metabolism
    102879869
   00830 Retinol metabolism
    102879869
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102879869
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102879869
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     102879869
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 Fer2
Other DBs
NCBI-GeneID: 102879869
NCBI-ProteinID: XP_024895083
LinkDB
Position
Unknown
AA seq 1088 aa
MPSLPNSDELIFFVNGRKVIEKNADPEVNLLFYLKKVHCLEGTWALFSLTPFLPYGCGGG
GCGACTVMVSRYNPKTKKIHHYPVTACLVPICSLYGAAVTTVEGVGSIKTRIHPVQETLA
KCHGTQCGFCSPGIVMSIYLLLRNHSELTPKQITKALGGNLCHCTGYRXSGKTFCEESTV
CQMKGSGKCCMDQEERSFVTRQEKLCTKLYNKDEFQPLDPSQEPIFPPELIVRYFTEMAE
DPNKRRLTFXGERTAWTTPVTLNNLVELKANFPKAPVVMGNTTVGPNVKFRDEFHPVFIS
PTGLPELYFADSTANGVTIGAGYSLAQLNDALHFIVSEQPKEKTKTYRALLKHLRTLAVT
RIRSMATLGGHVVSRPNFSDLNPILAAGNAVINLISKGKRPSFRHCHFSKYKVNGRFLNG
RALFLRSPEANLKSEEIALSVDIPHSTRCVNPHQPRQDPVGHPVMHQSAIEHTTGEAVXC
DDLPSISQELFLAVVTSTIAHAKIISIDVSEALTLPGVVDVITAENVPGNNSYQGGVLYA
QNEVICVSQIVCTVAAIYAHAREAAKKVKITYKDIELRIITIEQALEHNSFLSAEKKIEQ
GNVEEAFXHVNQIIGGKXDPREGQEHFYMEMQTILAIPKAEDKEMVLYLGTQFPTHVQEF
VAAALNITCHMKRAGGAFGGKLGKSALLGAVSAVAANKTGCPIQFILERGDDMLITAGRH
PLLGKHKIGFMNNGVIKAADLEYYINGGCAPDESEMVIEYIVLKSENTYYIPNFWCQGKA
CKTNLPSNTAFRGLGFPQATVVVEAYVTAVATQCDLLPEEVKEINMYKRISKTAYNQTFN
PEPLXKCXKECLEKSSFHARKQDAEEFNKKNYSKKRGLAVVPMKFTIGIPISYCTQAAAL
VRIYIDGSVLMTHGGCELGQGLHTKMIQGDDQEQNILSSYIHLSETSTITVPNTVMTAAS
VGTDNNGRAMPVASQEQNILSSYIHLSETSTITVPNTVMTAASVGTDNNGRAMPIEGAFI
QGMGLYTIEELKYSPEGVLYSRVQMTIKSPLSLKYQKSSHRLEVQDQDPNRRQEEKKQTP
GRVVLTNF
NT seq 3267 nt   +upstreamnt  +downstreamnt
atgccttctcttccaaattctgatgagttaattttttttgtgaatgggagaaaggtcata
gagaagaatgctgaccctgaagtaaacctactattctacctgaagaaagtccactgtctt
gaggggacctgggccctcttttccttgactcccttccttccatatggctgtgggggagga
ggctgcggcgcctgcaccgtcatggtgtcaagatacaaccccaagaccaagaaaatccac
cattatccagttacagcgtgcctagtgcccatctgctctctgtatggggctgcagtcacc
acagtagaaggtgtaggaagcatcaaaaccaggattcaccccgtgcaggagacacttgcc
aagtgtcatggcacgcagtgtggcttctgcagcccagggatagtgatgtccatctatctg
ctgctcaggaaccactcagagctgacccccaagcaaataaccaaagcgctcggaggtaat
ttgtgccactgtactggatatcganccagtgggaaaactttctgtgaggaatcaactgtt
tgtcaaatgaaaggatcaggaaaatgttgcatggatcaagaagagaggtcttttgtgact
agacaggaaaaattgtgtaccaaactgtataataaagatgaattccagcccttggatcca
tcccaggaacctatattccctcctgaacttatagtaagatattttacagaaatggcagaa
gatccaaacaagagaaggctgacattctgaggggagaggactgcctggactactccagta
actctcaacaaccttgtggagctgaaagccaacttccccaaagcccccgttgtcatgggg
aacactacagtgggacccaacgttaaattcagagatgaattccatccagttttcatatct
ccaactgggcttccagaattatattttgcagacagcacagctaatggggtgacaataggt
gcggggtacagcctggcccagttgaatgatgccttacattttattgtttcagagcaaccg
aaggagaagactaagacctaccgtgccctcctgaagcatctgaggacacttgccgtaacc
cggattaggagtatggcgactttaggaggacatgtggtgagcagacctaatttttctgac
ctaaatcctattttagcagctggaaatgctgtcatcaatctgatatctaaaggtaagaga
ccaagctttaggcattgtcatttctctaaatataaagtgaatggtagattcctgaatggt
agagcccttttcttgagatcacctgaagccaatcttaaatcagaagagattgcattgtct
gttgatattccccactccactaggtgtgtgaatccccaccaaccccgacaagatccagtt
ggccacccagtcatgcaccagtcagccattgaacacaccacaggggaagctgtgtagtgt
gatgacttgccttccatctcccaagaactcttcctggcagtagtcaccagcaccatagct
catgcaaagatcatatcaattgatgtttcagaagccctcacacttccaggtgttgttgat
gtgataacagcagagaatgttccaggaaataatagctatcagggaggagtgctctatgca
caaaatgaggtaatttgcgtgagtcagatcgtctgcaccgtggctgctatctatgctcat
gcgagagaggcagctaaaaaagtgaagataacttacaaagatatagaactgaggattatc
acaatagagcaagccctagagcacaattcatttctttctgctgagaagaaaattgagcaa
ggaaatgtagaggaagccttttaacatgttaatcaaattattggaggtaaatgagatcca
cgggaaggacaggaacatttttacatggaaatgcaaactatcctggctatcccaaaagca
gaagataaagaaatggtgttataccttggaacacagtttccaactcatgtgcaggaattt
gtggctgcagcactaaacatcacctgccatatgaaaagagctggaggagcatttggaggg
aaactgggcaagtctgctctgctaggagctgtcagtgctgtggctgccaataagactggc
tgcccaatccagtttattctagagcgtggtgatgacatgctgataactgctggccgccac
ccactcctcggaaaacacaagattgggtttatgaacaatggtgtgatcaaagctgctgat
cttgaatattatatcaatggcggatgcgctcctgatgaatctgagatggtgatagagtac
attgtgctgaaatctgaaaatacatattatattcctaatttctggtgccagggtaaagct
tgcaaaacaaatttgccatccaacactgcctttcgaggacttggctttccccaggctaca
gtggtagttgaagcttatgtaactgctgtagcaactcaatgtgacttactacctgaagaa
gttaaagaaataaacatgtataagagaattagcaaaacagcctataatcagacatttaat
ccagagcccttatgaaaatgcntgaaagaatgtctggagaaatcttcattccatgctagg
aaacaggatgccgaggaatttaataaaaagaattactcgaagaagagggggctggccgtg
gtccccatgaagtttaccattgggatccccataagctattgcactcaggctgccgctctt
gttcgtatctatattgatggctctgtcttgatgactcatggtggctgtgaattgggacaa
gggctccacaccaaaatgattcagggagatgatcaagagcagaacatcctctcatcatat
attcacctgtctgaaacaagcacaatcacagtgcccaatactgtcatgacggcagcgtcc
gtggggacagataacaacggaagggccatgcccgtggctagtcaagagcagaacatcctc
tcatcatatattcacctgtctgaaacaagcacaatcacagtgcccaatactgtcatgacg
gcagcgtccgtggggacagataacaacggaagggccatgcccattgaaggagcgtttatc
caaggcatgggactctataccatagaagaactgaaatactctccagaaggtgtactttat
tctcgagtccagatgactataaaatccccactgtcactgaaataccagaagagttctcac
aggctggaagtccaagatcaagatcccaacaggagacaggaagagaaaaagcaaactcct
ggcagagtggtgctcactaacttctga

KEGG   Pteropus alecto (black flying fox): 102895358
Entry
102895358         CDS       T02993                                 

Definition
(RefSeq) aldehyde oxidase 2
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00280  Valine, leucine and isoleucine degradation
pale00350  Tyrosine metabolism
pale00380  Tryptophan metabolism
pale00750  Vitamin B6 metabolism
pale00760  Nicotinate and nicotinamide metabolism
pale00830  Retinol metabolism
pale00982  Drug metabolism - cytochrome P450
pale01100  Metabolic pathways
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102895358
   00350 Tyrosine metabolism
    102895358
   00380 Tryptophan metabolism
    102895358
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    102895358
   00760 Nicotinate and nicotinamide metabolism
    102895358
   00830 Retinol metabolism
    102895358
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102895358
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102895358
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     102895358
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 102895358
NCBI-ProteinID: XP_006921394
LinkDB
Position
Unknown
AA seq 1345 aa
MPCPSRSDELFFFVNGRKVIERNADPEVTLLTFLRKNLGLTGTKYACGRGGCGACTVMVS
KCDPTSKKIRHFSITACLVPICSLYGAAITTVEGVGSIKTKLHPVQERIAKSHGTQCGFC
TPGMVMSMYTLLRNHPQPSEEQLMEALGGNLCRCTGYRPILESGRTFCVESNGCQQKGTG
NCCLDQGENDSFSRGRNSDISTELFTKDQFQPLDPTQELIFPPELLRMAENPEKRTLNFH
GERVTWISPGTLKDLLELKVKHPEAPLILGNTSLGPAMKSRGHLHPILLSPARISELNTV
SKTSEGLTIGAGCSLAQVKDILAERVSELPEEKARTYRALLKHLKSLAGQQIRNMASLGG
HIISRHFYSDLNPILAAGNATLNLISEAGTRQIPLNEHFLAGLASADLKPEEILESVYIP
HSQKWEFVSAFRQAQCQQNALADVNAGMRVLLKEGTDAIEDLSIAYGGVGTATVSARKSC
QQLLGRRWNELMLDEACRLLLDEVSLPGSAPGGKVEFKRTLVISFFFKFYLEVLQELKKL
AKLFSAPDCLHYPEISDQFLSALEDFPVTVPQGVQKYQSVDSRQPLQDPVGRPIMHVSGL
KHATGEAIFCDDIPRVDNELYMVLVTSTRAHAKIISIDLSEALELPGVVDVITAKDIPGT
NGAEDDKLLAVDEVLCVGQIICAVVAETNVQAKRATEKIKITYEDLEPVIFTIEEAIKHN
SFLCPEKKLEQGNIEEAFEKVDQIVEGEVHAGGQEHFYMETQRVLIIPKTEDKELDIYVS
TQDPAHVQKTVSSTLNVPINRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAIKTGHPIRL
VLDREDDMLITGGRHPLFGKYKVGFMNNGRIKALDIECFINGGCTLDDSEQVIEFLVLKL
ENAYKIRNLRFRGRACMTNLPSNTAFRGFGFPQGTLVTESCITAVAAKCGLLPEKIREKN
MYKTVDKTIYKQAFNPETLIRCWNECLDKSAFHSRRIQVEEFNKKNYWKKKGIAIIPMKF
SVGFAATSYHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELKIPMSYVHICE
TSTAMVPNTIATAASIGSDVNGRAVQNACQILLKRLEPIIKKNPDGTWEDWIEAAFEQRI
SLSATGYFRGYKAFMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIVMDACCS
LNPAIDIGQIEGSFIQGMGLYTTEELKYSPEGVLYSRGPDEYKIPTITDVPEEFNVSLLP
SSQTPLTIYSSKGLGESGMFLGSSVFFAIADAVATARRERDIAEDFTAKSPATPERVRMA
CADRFTEMIPRDDPKTFKPWSIPIA
NT seq 4038 nt   +upstreamnt  +downstreamnt
atgccctgcccctcgagatccgatgagttgtttttctttgtgaacgggaggaaggtgata
gagaggaatgcggaccctgaagtcactctgctgaccttcctacgaaagaacttaggcctc
acgggaaccaagtatgcctgtggaagaggaggctgtggtgcctgcaccgtgatggtgtct
aagtgtgaccccacatccaagaagataagacacttctccatcactgcatgcctggtgccc
atctgctctctgtatggagctgctatcaccactgtagaaggtgtcggaagcatcaaaacc
aagcttcatcccgtacaggaaaggatcgccaagagccacggcacccagtgcgggttttgc
acccctgggatggtgatgtccatgtacacactgctcaggaaccacccgcagccctcagag
gagcagctcatggaagccctgggaggtaatctatgccgctgcactgggtatcggccaatt
ctcgagagtggaaggacattctgcgtggagtcaaatggctgtcaacagaaaggaacagga
aactgctgcttggatcagggagaaaatgattctttctcacgtggcaggaacagtgacatt
tccacagagttatttacgaaagaccagttccagcctttggaccctacccaggagctcata
tttcccccagaactcttgagaatggcagagaacccagagaaaagaaccctgaactttcac
ggagagagggttacctggatctctcctgggaccctcaaggatctcctggagctgaaagtg
aaacaccccgaagcccctctcatccttggcaacacctcactaggacctgcaatgaaatct
cgaggacatttgcacccaattctcctctctcctgctaggatttctgagctgaatacggtg
tctaaaacaagcgagggactgacaataggtgctggctgcagtctggcccaggtgaaggac
atcttggctgaaagggtttctgagctcccggaggagaaagctcggacttatcgagccctc
ttgaagcacctgaagagtctggcaggccagcagatccggaatatggcgtccttaggagga
catatcataagccggcatttctattcggacctgaatccaattctggctgcgggcaacgct
accctcaatctgatatcagaagcaggtacgcggcagattcctctaaatgaacattttctt
gctgggttggcaagtgcagaccttaagccagaggaaattttggaatctgtgtatatccct
cattctcaaaagtgggaatttgtgtcagccttccgacaggctcagtgccagcaaaatgcc
ttggctgatgtgaatgctggcatgcgagtcctcctcaaagaaggcacagatgccattgag
gacctgagcatcgcctatggaggggtcgggacggccaccgtcagtgcacgcaaatcttgc
cagcagctgctagggaggcgctggaatgagctgatgctagatgaggcttgcaggctgctt
ctggacgaagtctccctcccaggctcagctccaggggggaaggtggaattcaagaggact
ctggtgatcagcttcttcttcaaattctacctagaagttctgcaggaactgaagaagcta
gcgaagctgttctctgcacctgactgccttcattaccctgaaatttcagaccagttccta
agcgctctagaagatttcccggtcacagtaccccagggagtccaaaaataccagagtgtg
gattctcgccagcccctccaagacccagtcggacgccccatcatgcatgtatcaggtctt
aaacatgccacaggtgaagctatattttgtgatgacatccctagggtggataacgagctg
tacatggtgttggtgaccagtaccagagcccatgcaaaaatcatatcaattgatttgtct
gaggctctcgaactacccggggtggttgatgtgataacagccaaagacattcctggcacc
aatggtgctgaagatgacaaactgttggctgtagacgaggtactctgtgtgggccagatc
atctgtgctgtggttgcagagacaaatgtacaggcaaagcgagccactgaaaagataaag
atcacttacgaagatctggagcccgtaatcttcaccatcgaggaggccataaaacacaac
tcattcctatgccctgaaaaaaaacttgaacaaggaaacattgaggaggcatttgaaaaa
gtagatcaaattgtcgaaggagaagtccatgctggaggacaagaacatttttacatggaa
acacaaagagtgctcattattccaaagacagaggacaaagaactagacatttatgtgtcg
acgcaggatccagcccacgtgcagaaaacagtgtcctctactttaaacgtccccatcaac
aggatcacctgtcatgtaaaacgagtgggtggaggttttggtgggaaggtaggaagacca
gctgtattcggagctattgcagctgtaggcgctatcaaaactggtcaccccattcgcctt
gttcttgatcgggaggatgatatgttaataaccgggggaagacacccattatttggaaaa
tataaagtgggattcatgaataacgggcgaatcaaagctctagacatcgagtgcttcatt
aacggaggatgcacactggacgattcggagcaggttatagaatttcttgtactaaagctg
gaaaacgcgtataaaatccgtaacctcaggttccggggccgtgcatgcatgacaaattta
ccgtccaatacagcctttcgaggatttggcttcccacaaggaaccctggtgacagaatct
tgcatcacagctgtggcagccaaatgtggccttctgccagaaaagatcagggagaaaaac
atgtacaaaactgttgataaaaccatctacaaacaagcattcaaccctgagaccctgata
agatgttggaacgaatgtctggacaaatctgcctttcacagcagaagaatacaagtggaa
gagtttaataaaaagaattactggaagaagaaaggcattgctattatccccatgaagttt
tcagtcggctttgccgctacaagctatcatcaggcagctgcactcgttcatatctacaca
gacgggtctgtattggtcacacatggaggcaatgaactgggacaaggtattcacaccaaa
atgctacaggtggccagccgtgaattaaaaatacccatgtcttatgtgcacatctgcgaa
acaagtacagccatggtgcctaatacaattgctacagcagcatccataggttcagatgtc
aacggcagagccgtgcagaatgcttgtcagatccttctgaaacgccttgagcccatcatt
aagaaaaatccagatggtacatgggaggactggatagaagctgcttttgaacaaagaatc
agtctttcagccaccggatacttcaggggctacaaggccttcatggactgggagaaggga
gagggtgacccgtttccatactatgtctatggagcagcctgttctgaggttgaaatcgac
tgtctgacaggagctcacaagaaaatcagaacagacatcgtcatggatgcatgttgcagc
ttaaatccggccattgatattgggcagattgaaggttcatttattcagggaatgggcctt
tataccactgaggagctaaaatattctccagaaggtgtcctatactctcgaggtccagat
gagtacaaaattccaaccatcactgatgtcccagaggagttcaatgtctccttgttgcca
tcatcacaaaccccactaaccatctattcatccaagggcctgggggagtctgggatgttc
ctagggtcatctgtattctttgccattgctgacgctgtggccacagcacgcagggagaga
gacatagccgaggacttcacagcgaagagtccagcgacgccagagcgtgttcgaatggcc
tgtgcagatcggtttacagagatgattccaagagatgaccctaagacatttaaaccttgg
tctatccctatagcataa

DBGET integrated database retrieval system