KEGG   Pteropus alecto (black flying fox): 102879898
Entry
102879898         CDS       T02993                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04014  Ras signaling pathway
pale04390  Hippo signaling pathway
pale04392  Hippo signaling pathway - multiple species
pale05200  Pathways in cancer
pale05206  MicroRNAs in cancer
pale05219  Bladder cancer
pale05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102879898 (RASSF1)
   04390 Hippo signaling pathway
    102879898 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    102879898 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102879898 (RASSF1)
   05206 MicroRNAs in cancer
    102879898 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    102879898 (RASSF1)
   05223 Non-small cell lung cancer
    102879898 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH Mst1_SARAH
Other DBs
NCBI-GeneID: 102879898
NCBI-ProteinID: XP_006909196
LinkDB
Position
Unknown
AA seq 334 aa
MRPELEPAGYISVLTVAAVTRVLAHAHTGKCARAGARASGAVVGDYRRTEVRLLAGGRAG
AAMGEVDAGTPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLVRRPRRDQDEPVEWD
IPDLSQAEIEQKVKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKAPTLQ
DARRGPARGPAVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFE
RAERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLR
ILQREEEEHLRQILQKYSFCRQKIQEALHACPLG
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgagaccagagctagagcctgctggctacatttcagtgctaacggttgcagcagtgaca
cgggttttggcgcacgcgcacacgggcaagtgcgcacgcgcaggcgcacgcgcgtctggg
gcggtggttggagactaccggcgcaccgaggtccggctgctggctggcgggcgagcgggc
gcggcgatgggtgaggtagatgcggggacgccctccttcgagatgacctggagcagcacg
acaagcagtggttactgcagccaggaggactcggactcggagctcgagcagtactttacg
gcgcgtacttcgctagtgcgccggccgcgcagggaccaggatgaacctgtggagtgggat
atacctgacctttctcaggctgagattgagcagaaggtcaaggagtacaatggccaaatc
aacagcaacctcttcatgagcctgaacaaagacggctcctacacaggcttcattaaggtt
cagctgaagttggtgcgccctgtctcggtgccctccagcaagaaggcacccacgttgcag
gatgcccgacggggcccagcgcggggtccagctgtgaggcgccgcacctccttctacctg
cccaaggatgctgtcaagcaccttcatgtgttgtcacgcacacgggcaagagaggtcatc
gaggccctgctgcgcaagttcttggtggtggatgacccccgcaagtttgcgctttttgag
cgagctgagcgccatggccaagtatacctccggaagctgtcagatgatgagcagcccctg
cggctacggctccttgcagggcctagtgagaaagccctaagctttgtcctgaaagagaat
gactctggggaggtgaactgggatgccttcagcatgcctgaactacacaacttcctccgc
atcctgcagcgggaggaagaggaacacctccggcagatcctgcagaagtactccttttgc
cgccagaagatccaggaggccctgcacgcctgccccctggggtga

DBGET integrated database retrieval system