KEGG   Pteropus alecto (black flying fox): 102879945
Entry
102879945         CDS       T02993                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X1
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00220  Arginine biosynthesis
pale00330  Arginine and proline metabolism
pale01100  Metabolic pathways
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04066  HIF-1 signaling pathway
pale04071  Sphingolipid signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04370  VEGF signaling pathway
pale04371  Apelin signaling pathway
pale04611  Platelet activation
pale04915  Estrogen signaling pathway
pale04921  Oxytocin signaling pathway
pale04926  Relaxin signaling pathway
pale04931  Insulin resistance
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102879945 (NOS3)
   00330 Arginine and proline metabolism
    102879945 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102879945 (NOS3)
   04371 Apelin signaling pathway
    102879945 (NOS3)
   04066 HIF-1 signaling pathway
    102879945 (NOS3)
   04020 Calcium signaling pathway
    102879945 (NOS3)
   04071 Sphingolipid signaling pathway
    102879945 (NOS3)
   04022 cGMP-PKG signaling pathway
    102879945 (NOS3)
   04151 PI3K-Akt signaling pathway
    102879945 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102879945 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102879945 (NOS3)
   04921 Oxytocin signaling pathway
    102879945 (NOS3)
   04926 Relaxin signaling pathway
    102879945 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102879945 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102879945 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102879945 (NOS3)
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102879945 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 102879945
NCBI-ProteinID: XP_006920687
LinkDB
Position
Unknown
AA seq 1207 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPVSEPNWTPAPAPLPEPDHSPTLALNS
PPPTRSPEGPKFPRVKNWEVGSITYDTLSARAQQDGPCTPRRCLGSLVFPRKLQGRPSQG
PPPPEQLLSQARDFIDQYYSAIKRSGSQAHEQRLEEVEAEVAATGTYQLRESELVFGAKQ
AWRNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICSHIKYATNKGNLRSAITVFPQRTP
GRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAP
DESPELFTLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGW
YMSTEIGSRNLCDPHRYNILEDVAVCMDLDTRTSSSLWKDKAAVEINLAVLHSYQLAKVT
IVDHHAATSSFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQ
PDPWKGSTAKGAGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQ
QLGRLFRKAFDPRVLCMDEYDVVFLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGP
YNSSPRPEQHRSYKIRFNSVSCSDPLVSSWRRKRKASSNTDSAGALGTLRFCVFGLGSRA
YPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDA
KAAARDIFSPKRSWKRQRYRLSAQAEGLQLLPGLTYVHRRKMFQATVLSVENLQSSKSTR
ATILVRLDTGGQEGLQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPGEAMAVEQLEKGS
PGGPPPGWVRDPRLPPCTLRQALTFFLDITSPPSPRLLQLLSTLAEEPGEQQELETLSQD
PRRYEEWKWFRCPTLLEVLEQFPSVALPAALLLTQLPLLQPRYYSVSSAPSAHPGEIHLT
VAVLAYRTQDGLGPLHYGVCSTWLSQLKAGAPVPCFIRGAPSFRLPPDPSLPCILVGPGT
GIAPFRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVFGRVLTA
FSREPASPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGD
MELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWSFDPP
GPDTPGP
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtgggccaggagcctgggccaccctgcggcctggggctggga
ctgggcctcgggctgtgcggcaagcagggcccagcctccccggtgtctgagcccaactgg
acgccagcacctgcacccctgcctgagccagaccacagccccaccctggctctcaacagc
cccccgcccacccggtccccggaggggcccaagttccctcgcgtgaagaactgggaagtg
gggagcatcacctacgacaccctgagtgcccgggcacagcaggacggaccctgcacccca
agacgctgcctgggctccctggtatttccacggaaactgcagggacggccatcccagggc
cccccaccccccgagcagctgctgagccaggccagggacttcatcgaccagtactacagc
gccatcaagcggagcggctcccaggcccacgagcagcggcttgaggaggtggaagccgag
gtggcagccacaggcacctaccagcttcgggaaagcgagctagtgttcggggccaagcag
gcctggcgcaacgctccccgctgcgtgggccggatccagtgggggaagctgcaggtgttt
gacgcccgtgattgcagctctgctcaggagatgttcacctacatctgtagccacatcaag
tatgccaccaacaagggcaacctccgctccgcaatcacagtgttcccccaacgcaccccg
ggccgcggggacttccgcatctggaacagccagctggtgcgctacgcgggctaccggcag
caggacggctcggtgcgcggggacccagccaacgtggaaatcaccgagctctgcatccag
cacggctggaccccgggaaacggccgcttcgacgtgctgcccctgctgctccaggcccca
gacgagtccccagaactcttcactctaccccccgagctagtcctcgaggtgcccctggag
caccccacgctggagtggttcgcggccctggggctgcgctggtacgccctcccggccgtg
tccaacatgctgctggagatcgggggcctggagttcccagcggcgcccttcagcggctgg
tacatgagcacggagatcggctcgcggaacctgtgtgacccgcaccgctacaacatcctg
gaggatgtggccgtctgcatggacctggacacccggacgtcctcgtccctgtggaaagac
aaggcggccgtggaaatcaacttggcggtgctgcacagttaccagctggccaaagtgacc
attgtggaccaccatgccgccacctcctccttcatgaagcacctggagaacgagcagaag
gcgagggggggctgccctgccgattgggcctggatcgtgccccccatctcgggcagcctc
acccctgtgttccatcaggagatggtcaactatttcctgtcccctgccttccgctaccag
ccggatccgtggaaggggagcacagccaagggtgccggcatcaccaggaaaaagaccttt
aaggaagtggccaatgctgtgaagatctctgcctcactcatgggcaccgtgatggccaag
cgtgtgaaggccacaatcctgtatggctctgagaccggccgggcccagagctatgcacag
cagctggggaggctcttccggaaggctttcgacccccgggtcctgtgcatggatgagtat
gacgtggtgttcctcgagcacgagacgctggtgttggtggtgaccagcacatttgggaat
ggggatcccccagaaaatggagagagtttcgcggcggccctgatggagatgtccggcccc
tacaacagctcccctcggcccgagcagcacaggagttacaaaatccgcttcaacagcgtc
tcttgctcagaccccctcgtgtcctcctggcggcggaagagaaaggcgtccagtaacacg
gacagcgccggggccctggggaccctcaggttctgtgtgttcgggctgggctcccgggcg
tacccccacttctgtgcctttgctcgtgcggtggacacacggctggaagagctgggcggg
gagcggctcctgcagctgggccagggcgacgagctgtgcggccaggaggaggccttccgc
ggctgggcccaggctgccttccaggcctcctgtgagaccttctgcgtgggagaggatgcc
aaggccgccgcccgggacatattcagccccaaacggagctggaagcgccagaggtaccgg
ctgagtgcccaggctgagggcctccagctgctgccaggcctgacctacgtgcacagacga
aagatgttccaggccacagtcctctcagtggaaaacctgcagagcagcaagtccactcgg
gccacgatcctcgtgcgcctggacaccggaggccaggaggggctccagtaccagccaggg
gaccacataggcatctgcccgcccaaccggcccggcctcgtggaggcgctgctgagccgt
gtggaggacccgccgccgccgggcgaggccatggccgtggagcagctggagaagggcagc
cccggtggccctcccccgggctgggtgcgggacccccggctgcccccgtgcaccctgcgc
caggctctcaccttcttcctggacatcacttccccgcccagcccccgactccttcaactg
ctcagcaccctggctgaagagcccggcgaacagcaggagctagagaccctcagccaggac
ccccggcgctacgaggagtggaagtggttccgctgccccacgctgctggaggtgctggag
cagtttccgtccgtggctctgcccgccgcgctgctcctcacccagctgcccctgctccag
ccccggtactactccgtcagctcggcgcccagcgcccaccccggagagatccacctcacg
gtggccgtgctggcatacaggacccaggatgggctgggccccctgcactacggcgtctgc
tccacgtggctgagccagctcaaggccggagcccctgtcccctgcttcatcaggggggct
ccctccttccggctgccaccggaccccagcttgccctgcatcctggtgggcccaggcact
ggcatcgcccccttccggggcttctggcaggagcggctacatgacattgagagcaaaggg
ctgcagcccgcccctatgaccttggtgttcggctgccgatgctcccagctcgaccacctc
taccgcgacgaggtgcaggatgcccagcagcgcggagtgttcggccgtgtcctcactgcc
ttctcccgggaacccgccagccctaagacctacgtacaggacatcctgcggacagagctg
gctgctgaggtgcaccgcgtgctgtgcctcgaacgaggccacatgtttgtctgcggcgat
gtcaccatggcaaccagcgtcctgcagacagtgcagcgcatactggcgacagagggcgac
atggagctggatgaggccggagacgtcatcggcgtgctgcgggatcagcaacgctatcac
gaggacattttcgggcttacgctacgcacccaggaggtgacaagccgcattcgcacccag
agcttttccttgcaggagcggcatctgcgcggcgcagtgccctggtcgttcgacccgccc
ggcccagacacgcccggcccctga

DBGET integrated database retrieval system