KEGG   Pteropus alecto (black flying fox): 102880017
Entry
102880017         CDS       T02993                                 

Gene name
CTNNB1
Definition
(RefSeq) LOW QUALITY PROTEIN: catenin beta-1
  KO
K02105  catenin beta 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04015  Rap1 signaling pathway
pale04310  Wnt signaling pathway
pale04390  Hippo signaling pathway
pale04510  Focal adhesion
pale04520  Adherens junction
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04670  Leukocyte transendothelial migration
pale04916  Melanogenesis
pale04919  Thyroid hormone signaling pathway
pale04934  Cushing syndrome
pale05010  Alzheimer disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05100  Bacterial invasion of epithelial cells
pale05132  Salmonella infection
pale05160  Hepatitis C
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05210  Colorectal cancer
pale05213  Endometrial cancer
pale05215  Prostate cancer
pale05216  Thyroid cancer
pale05217  Basal cell carcinoma
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05412  Arrhythmogenic right ventricular cardiomyopathy
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102880017 (CTNNB1)
   04310 Wnt signaling pathway
    102880017 (CTNNB1)
   04390 Hippo signaling pathway
    102880017 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102880017 (CTNNB1)
   04520 Adherens junction
    102880017 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102880017 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102880017 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102880017 (CTNNB1)
   04916 Melanogenesis
    102880017 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102880017 (CTNNB1)
   05205 Proteoglycans in cancer
    102880017 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102880017 (CTNNB1)
   05225 Hepatocellular carcinoma
    102880017 (CTNNB1)
   05226 Gastric cancer
    102880017 (CTNNB1)
   05216 Thyroid cancer
    102880017 (CTNNB1)
   05217 Basal cell carcinoma
    102880017 (CTNNB1)
   05215 Prostate cancer
    102880017 (CTNNB1)
   05213 Endometrial cancer
    102880017 (CTNNB1)
   05224 Breast cancer
    102880017 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102880017 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    102880017 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102880017 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102880017 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102880017 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102880017 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    102880017 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102880017 (CTNNB1)
   05163 Human cytomegalovirus infection
    102880017 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102880017 (CTNNB1)
   05165 Human papillomavirus infection
    102880017 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 102880017
NCBI-ProteinID: XP_006914879
LinkDB
Position
Unknown
AA seq 780 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHP
TNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLS
KKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKXNPALV
KMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCL
QILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAG
GMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAA
GILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMA
QNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLV
RAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQ
LLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFR
MSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHS
GGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagacagaaaagca
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttccctgagtggtaaaggcaatcctgaggaggaagacgtggatactacc
cagcaagtcctgtacgagtgggaacagggattttctcagtccttcacgcaagaacaagta
gctgatattgatggacagtatgcaatgactcgagctcagagggtacgagctgccatgttt
cctgagacattagatgagggtatgcagatcccgtctacacagtttgatgctgctcatccc
actaacgttcagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaatttg
attaactatcaagatgatgccgaacttgccacgcgtgcaatccctgagttgacaaaactg
ctaaatgatgaggaccaggtggtggtgaataaagcagcagttatggtccatcagctttct
aaaaaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgta
cgtactatgcagaatacaaatgatgtggaaacagctcgttgtactgctgggaccttgcac
aatctttcccatcatcgtgagggcttgctggccatctttaagtaaaatcctgccctggtg
aagatgcttggttcaccggtggattctgtattgttttatgccattacaactcttcacaac
cttttattgcatcaggagggagctaaaatggcagtgcgtttagctggcggactgcagaaa
atggtcgccttgctcaacaaaacaaacgttaaattcttggctattacgacagactgcctt
cagattttagcttatggcaatcaagagagcaagctgatcattctggctagcggtggacct
caagctttagtaaatataatgaggacctacacttatgagaagctactgtggaccacaagc
agagtactgaaggtgctgtctgtctgctctagtaataagccggctattgtagaagctggt
ggaatgcaagctttaggacttcacctgacagatccaagtcagcgccttgttcagaactgt
ctttggactcttaggaatctttcagatgctgcaactaagcaggaagggatggaaggtctt
cttggaacccttgttcagctgctgggctccgatgatatcaatgtggtcacttgtgccgct
ggaattctctctaatctcacttgcaataattacaagaacaagatgatggtgtgccaagtg
ggtggtatagaggccctcgtgcgtactgtccttcgtgcgggtgatagggaggacatcact
gagcctgccatctgtgctcttcgtcatctgaccagtcgacaccaggaagcagagatggcc
cagaatgctgttcgccttcactatggactaccagttgtggttaaactcctacacccacca
tcccactggcctctgataaaggctactgttggattgattcgaaatcttgccctttgtccg
gcaaatcatgcacctttgcgtgagcagggtgccattccacgcctagttcagttactggtt
cgtgcacatcaggacacccagcgccgtacgtctatgggcggaacacagcagcagttcgtg
gagggggtccgcatggaagaaatagttgaaggttgtaccggagcccttcacatcctagct
cgcgatgttcacaaccgaatcgtaatcagaggactgaataccattccattgttcgtgcag
ctgctttattctcccattgaaaatatccaaagagtagctgcgggggtcctctgcgaactt
gctcaggacaaggaggctgcggaagctatcgaagccgagggagccacagcccctctgaca
gagttgcttcactccaggaatgagggcgtggcaacatatgcagctgctgttttgttccga
atgtctgaggacaagccacaggactataagaaacggctttcagtcgagctgaccagttct
ctgttcagaacggagcccatggcttggaatgagaccgctgatcttggacttgatatcggt
gcccagggagaaccccttggatatcgccaggatgatcccagctatcgttcttttcactct
ggtggatatggccaggatgccttgggtatggaccccatgatggagcatgagatgggtggc
caccaccctggtgctgactatccagtggatgggctgccagatctggggcatgcccaggac
ctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgacctg
taa

DBGET integrated database retrieval system