KEGG   Pteropus alecto (black flying fox): 102880029
Entry
102880029         CDS       T02993                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04114  Oocyte meiosis
pale04218  Cellular senescence
pale04310  Wnt signaling pathway
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04380  Osteoclast differentiation
pale04625  C-type lectin receptor signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04720  Long-term potentiation
pale04724  Glutamatergic synapse
pale04728  Dopaminergic synapse
pale04921  Oxytocin signaling pathway
pale04922  Glucagon signaling pathway
pale04924  Renin secretion
pale05010  Alzheimer disease
pale05014  Amyotrophic lateral sclerosis
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05031  Amphetamine addiction
pale05152  Tuberculosis
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102880029 (PPP3CA)
   04310 Wnt signaling pathway
    102880029 (PPP3CA)
   04370 VEGF signaling pathway
    102880029 (PPP3CA)
   04020 Calcium signaling pathway
    102880029 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    102880029 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102880029 (PPP3CA)
   04218 Cellular senescence
    102880029 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102880029 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    102880029 (PPP3CA)
   04660 T cell receptor signaling pathway
    102880029 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    102880029 (PPP3CA)
   04659 Th17 cell differentiation
    102880029 (PPP3CA)
   04662 B cell receptor signaling pathway
    102880029 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102880029 (PPP3CA)
   04921 Oxytocin signaling pathway
    102880029 (PPP3CA)
   04924 Renin secretion
    102880029 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102880029 (PPP3CA)
   04728 Dopaminergic synapse
    102880029 (PPP3CA)
   04720 Long-term potentiation
    102880029 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    102880029 (PPP3CA)
   04380 Osteoclast differentiation
    102880029 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102880029 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102880029 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    102880029 (PPP3CA)
   05020 Prion disease
    102880029 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    102880029 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    102880029 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102880029 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102880029 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    102880029 (PPP3CA)
   05163 Human cytomegalovirus infection
    102880029 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102880029 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102880029 (PPP3CA)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102880029 (PPP3CA)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     102880029 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 102880029
NCBI-ProteinID: XP_006918933
LinkDB
Position
Unknown
AA seq 511 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAM
PSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgacggacagggtggtgaaagct
gtcccatttcctccaagtcaccggcttacagcaaaagaagtgtttgataacgatgggaaa
cctcgtgtggatatcttaaaggcacatctcatgaaggaaggcaggctggaagagagtgtg
gcattgagaataataacagagggagcttcaattcttcgacaggaaaaaaatttgctggat
attgatgcaccagtcacagtttgtggggacatccatggacaattttttgacttgatgaag
ctcttcgaagtggggggatctcctgccaacactcgctacctcttcttaggggactatgtg
gacagagggtacttcagcatcgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttactccgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaaatattcagaacgtgtctatgacgcctgtatggac
gcctttgactgcctgcctctggctgccctgatgaaccagcagttcctgtgtgtacacggt
ggtctgtctccagagattaacaccttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcttatggacctatgtgcgatatcttgtggtcagaccccctggaggactttggc
aatgagaagactcaggaacattttactcacaacacagtcaggggatgttcgtacttctac
agttacccagctgtttgtgaattcttacagcacaataacttgttatctatactccgagcc
catgaagcccaagatgcagggtatcgcatgtacaggaaaagccaaacaacaggcttccct
tctctaattacaattttttcagcaccaaattacttagatgtgtacaataacaaagctgcg
gtattgaagtatgagaacaatgtcatgaacatcaggcaattcaactgttctcctcatcca
tactggcttccaaatttcatggatgttttcacttggtccctgccatttgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctcagatgatgaacttgggtcagaa
gaagatggatttgatggagccacagctgctgcccggaaggaggtgataaggaacaagatc
cgagcaataggcaaaatggccagagtgttctcggttctcagagaagagagtgagagcgtg
ctgacgctgaaaggcctgacccccacgggcatgctccccagtggagtgctttctggaggg
aagcaaacactgcaaagcgctatcaaaggattttcaccacaacataagatcactagcttc
gaggaggccaagggcttagaccgaattaacgagaggatgccacctcgcagagatgccatg
ccctctgacgccaaccttaactccatcaacaaggctctcgcctcagagactaacggcacg
gacagcaatggcagtaatagcagcaatattcagtga

KEGG   Pteropus alecto (black flying fox): 102883156
Entry
102883156         CDS       T02993                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04114  Oocyte meiosis
pale04218  Cellular senescence
pale04310  Wnt signaling pathway
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04380  Osteoclast differentiation
pale04625  C-type lectin receptor signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04720  Long-term potentiation
pale04724  Glutamatergic synapse
pale04728  Dopaminergic synapse
pale04921  Oxytocin signaling pathway
pale04922  Glucagon signaling pathway
pale04924  Renin secretion
pale05010  Alzheimer disease
pale05014  Amyotrophic lateral sclerosis
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05031  Amphetamine addiction
pale05152  Tuberculosis
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102883156 (PPP3CB)
   04310 Wnt signaling pathway
    102883156 (PPP3CB)
   04370 VEGF signaling pathway
    102883156 (PPP3CB)
   04020 Calcium signaling pathway
    102883156 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    102883156 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102883156 (PPP3CB)
   04218 Cellular senescence
    102883156 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102883156 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    102883156 (PPP3CB)
   04660 T cell receptor signaling pathway
    102883156 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    102883156 (PPP3CB)
   04659 Th17 cell differentiation
    102883156 (PPP3CB)
   04662 B cell receptor signaling pathway
    102883156 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102883156 (PPP3CB)
   04921 Oxytocin signaling pathway
    102883156 (PPP3CB)
   04924 Renin secretion
    102883156 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    102883156 (PPP3CB)
   04728 Dopaminergic synapse
    102883156 (PPP3CB)
   04720 Long-term potentiation
    102883156 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    102883156 (PPP3CB)
   04380 Osteoclast differentiation
    102883156 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102883156 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102883156 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    102883156 (PPP3CB)
   05020 Prion disease
    102883156 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    102883156 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    102883156 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102883156 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102883156 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    102883156 (PPP3CB)
   05163 Human cytomegalovirus infection
    102883156 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102883156 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102883156 (PPP3CB)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102883156 (PPP3CB)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     102883156 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 102883156
NCBI-ProteinID: XP_006915577
LinkDB
Position
Unknown
AA seq 480 aa
MDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFF
DLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHL
TEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEVHTLDDIRRLD
RFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
IIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNC
SPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEI
IRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAE
KAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHSAQ
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggatgggatacctagggttgatgttctgaagaaccacttagtaaaagaaggtcgggta
gatgaagaaattgcacttagaattatcaatgagggtgctgccatccttcggagagagaaa
accatgatagaagtagaggctccaattacagtgtgtggtgacatccatggccaatttttt
gatctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttctt
ggtgattatgtggacagaggttattttagtatagagtgtgtcttatatttatgggtcctg
aagattctatacccaagcacattatttcttctaagaggcaatcatgaatgcagacacctt
actgaatattttacctttaagcaggaatgtaaaattaaatattcagaaagagtctatgaa
gcttgtatggaagcttttgatagcctgcctcttgctgcacttttaaatcaacaatttctt
tgtgttcatggtggactttcaccagaagtacacacactggatgatattaggagattagat
agattcaaagagccacctgcatttggaccaatgtgtgacttgctatggtccgatccttct
gaagattttggaaatgaaaaatcacaggaacattttagtcacaatacagttcgaggatgt
tcttatttttataactatccagcagtgtgtgaatttttgcaaaacaataatttgttatcg
attattagagctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaaact
acagggttcccttcattaataacaattttttcggcacctaattacttagatgtctacaat
aataaagctgctgtattaaagtatgaaaataatgtgatgaatattcgacaatttaactgt
tctccacatccttactggttgcccaattttatggatgtcttcacatggtctttaccattt
gttggagagaaagtgacagaaatgttggttaatgttctgagtatttgctccgatgatgaa
ctgatgactgaaggtgaagaccagtttgatgtaggttcagctgcagcccggaaagaaatc
ataagaaacaaaattcgagcaattggcaagatggcaagggtcttctctgttctcagggag
gagagtgaaagtgtgctgacactcaagggcctgactcccacagggatgttgcctagtgga
gtgttggctggaggacggcagaccctgcaaagtgccacagttgaggctattgaggctgaa
aaagcaatacgaggattctctccaccacatagaatctgcagttttgaagaggcaaagggt
ttggataggatcaatgagagaatgccaccccggaaagatgctgtacagcaagatggtttc
aattctctgaacaccgcacatgccactgagaaccacgggactggcaaccatagtgcccag
tga

KEGG   Pteropus alecto (black flying fox): 102894471
Entry
102894471         CDS       T02993                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04114  Oocyte meiosis
pale04218  Cellular senescence
pale04310  Wnt signaling pathway
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04380  Osteoclast differentiation
pale04625  C-type lectin receptor signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04720  Long-term potentiation
pale04724  Glutamatergic synapse
pale04921  Oxytocin signaling pathway
pale04922  Glucagon signaling pathway
pale04924  Renin secretion
pale05010  Alzheimer disease
pale05014  Amyotrophic lateral sclerosis
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05031  Amphetamine addiction
pale05152  Tuberculosis
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102894471 (PPP3R1)
   04310 Wnt signaling pathway
    102894471 (PPP3R1)
   04370 VEGF signaling pathway
    102894471 (PPP3R1)
   04020 Calcium signaling pathway
    102894471 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    102894471 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102894471 (PPP3R1)
   04218 Cellular senescence
    102894471 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102894471 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    102894471 (PPP3R1)
   04660 T cell receptor signaling pathway
    102894471 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    102894471 (PPP3R1)
   04659 Th17 cell differentiation
    102894471 (PPP3R1)
   04662 B cell receptor signaling pathway
    102894471 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102894471 (PPP3R1)
   04921 Oxytocin signaling pathway
    102894471 (PPP3R1)
   04924 Renin secretion
    102894471 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102894471 (PPP3R1)
   04720 Long-term potentiation
    102894471 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    102894471 (PPP3R1)
   04380 Osteoclast differentiation
    102894471 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102894471 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102894471 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    102894471 (PPP3R1)
   05020 Prion disease
    102894471 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    102894471 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    102894471 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102894471 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102894471 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    102894471 (PPP3R1)
   05163 Human cytomegalovirus infection
    102894471 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102894471 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102894471 (PPP3R1)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102894471 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 102894471
NCBI-ProteinID: XP_006909598
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt
aaaaggctagggaagagatttaagaagcttgatttggacaattctggttctttgagcgtg
gaagagttcatgtctctgccggagttacaacagaatccgttagtacagcgagtcatagat
atattcgacacagatgggaatggagaagtagattttaaagaattcattgagggagtctct
cagttcagtgtcaaaggcgataaggaacagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

KEGG   Pteropus alecto (black flying fox): 102895490
Entry
102895490         CDS       T02993                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04114  Oocyte meiosis
pale04218  Cellular senescence
pale04310  Wnt signaling pathway
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04380  Osteoclast differentiation
pale04625  C-type lectin receptor signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04720  Long-term potentiation
pale04724  Glutamatergic synapse
pale04921  Oxytocin signaling pathway
pale04922  Glucagon signaling pathway
pale04924  Renin secretion
pale05010  Alzheimer disease
pale05014  Amyotrophic lateral sclerosis
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05031  Amphetamine addiction
pale05152  Tuberculosis
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102895490 (PPP3R2)
   04310 Wnt signaling pathway
    102895490 (PPP3R2)
   04370 VEGF signaling pathway
    102895490 (PPP3R2)
   04020 Calcium signaling pathway
    102895490 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    102895490 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102895490 (PPP3R2)
   04218 Cellular senescence
    102895490 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102895490 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    102895490 (PPP3R2)
   04660 T cell receptor signaling pathway
    102895490 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    102895490 (PPP3R2)
   04659 Th17 cell differentiation
    102895490 (PPP3R2)
   04662 B cell receptor signaling pathway
    102895490 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102895490 (PPP3R2)
   04921 Oxytocin signaling pathway
    102895490 (PPP3R2)
   04924 Renin secretion
    102895490 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102895490 (PPP3R2)
   04720 Long-term potentiation
    102895490 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    102895490 (PPP3R2)
   04380 Osteoclast differentiation
    102895490 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102895490 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102895490 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    102895490 (PPP3R2)
   05020 Prion disease
    102895490 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    102895490 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    102895490 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102895490 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102895490 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    102895490 (PPP3R2)
   05163 Human cytomegalovirus infection
    102895490 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102895490 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102895490 (PPP3R2)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102895490 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 IL1_propep
Other DBs
NCBI-GeneID: 102895490
NCBI-ProteinID: XP_006911571
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPEEMCSHFDNDEIKRLSKSFKKLDLDSSGTLSVDEFLSLSQLQQNPLVQRVIE
VFDTDGNGEVDFKEFILGTSQFSVKGDKEQKLRFAFNIYDIDKDGYISNGELFQVLKMMV
GGNLKDWQLQQLVDKTIIILDTDGDGKISFEEFSAVVGGLEIHKKLVVVV
NT seq 513 nt   +upstreamnt  +downstreamnt
atggggaatgaggccagttacccggaggagatgtgctcccacttcgataacgatgaaatt
aaaaggttaagcaagagttttaagaagctggacttggactcttcggggactctgagcgtg
gacgagttcttgtccctgtcccagctgcagcagaacccgttggtgcagcgagtgatcgag
gtctttgacaccgacggcaacggagaagtggacttcaaggaattcatcttggggacctcc
cagtttagtgtcaagggggacaaggagcagaagctaaggtttgctttcaacatttacgac
atagataaagatggctacatttccaacggggagctcttccaggtgctgaagatgatggta
gggggcaacctgaaagactggcagttacagcagctggtggacaaaaccatcatcatcctg
gatacagacggcgatgggaaaatatccttcgaggaattcagtgctgtagttggaggccta
gagatccacaagaagctggtggtagttgtgtga

KEGG   Pteropus alecto (black flying fox): 102898473
Entry
102898473         CDS       T02993                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04114  Oocyte meiosis
pale04218  Cellular senescence
pale04310  Wnt signaling pathway
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04380  Osteoclast differentiation
pale04625  C-type lectin receptor signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04720  Long-term potentiation
pale04724  Glutamatergic synapse
pale04728  Dopaminergic synapse
pale04921  Oxytocin signaling pathway
pale04922  Glucagon signaling pathway
pale04924  Renin secretion
pale05010  Alzheimer disease
pale05014  Amyotrophic lateral sclerosis
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05031  Amphetamine addiction
pale05152  Tuberculosis
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102898473 (PPP3CC)
   04310 Wnt signaling pathway
    102898473 (PPP3CC)
   04370 VEGF signaling pathway
    102898473 (PPP3CC)
   04020 Calcium signaling pathway
    102898473 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    102898473 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102898473 (PPP3CC)
   04218 Cellular senescence
    102898473 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102898473 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    102898473 (PPP3CC)
   04660 T cell receptor signaling pathway
    102898473 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    102898473 (PPP3CC)
   04659 Th17 cell differentiation
    102898473 (PPP3CC)
   04662 B cell receptor signaling pathway
    102898473 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102898473 (PPP3CC)
   04921 Oxytocin signaling pathway
    102898473 (PPP3CC)
   04924 Renin secretion
    102898473 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    102898473 (PPP3CC)
   04728 Dopaminergic synapse
    102898473 (PPP3CC)
   04720 Long-term potentiation
    102898473 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    102898473 (PPP3CC)
   04380 Osteoclast differentiation
    102898473 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102898473 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102898473 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    102898473 (PPP3CC)
   05020 Prion disease
    102898473 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    102898473 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    102898473 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102898473 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102898473 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    102898473 (PPP3CC)
   05163 Human cytomegalovirus infection
    102898473 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102898473 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102898473 (PPP3CC)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102898473 (PPP3CC)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     102898473 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 102898473
NCBI-ProteinID: XP_006904444
LinkDB
Position
Unknown
AA seq 525 aa
MSGRNLHLSTTERVIKAVPFPPTQRLTLKEVFENGKPKIDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMDTFDC
LPLAALLNQQFLCVHGGMSPEITCLDDIRKLDRFKEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISEDEIEGGTTVRKEIIKNKIRAIGKMARVFSILREESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHRIRSFEEARGLDRINERMPPR
KDSQYSDGPVKLVTPVQSNAALRSDKGRKTSSDSEPSCGTGGPKT
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgtccgggaggaacctccacctctccaccaccgaacgcgtcatcaaagctgtccccttt
cctccaacccaacggcttactttgaaggaagtgtttgagaatgggaaacctaaaattgac
gttttgaaaaaccatttggtaaaagaagggcgactggaagaggaagtagccttaaagata
attaatgatggggctgccatcctgagacaagagaagactatgatagaagtagatgctcca
atcacggtgtgtggtgacattcatggacaattctttgacctgatgaagttgtttgaagtt
ggaggatcacctagtaacacacgctacctctttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtactgtatttatggagtttaaagataaaccatcccaaaacgttg
tttctgcttcggggaaatcatgaatgcaggcatcttacagaatacttcaccttcaaacag
gaatgtcgaatcaaatattctgagcaggtgtatgatgcgtgtatggatacatttgactgt
cttcctcttgctgccctcttaaatcagcagtttctgtgtgtacatggagggatgtcacct
gaaattacttgtttagatgacattaggaaattagacaggtttaaagaacctccagccttt
gggccagtgtgtgacctgctttggtccgacccctcagaagattatggcaatgaaaagacc
ttggagcactatacccacaacactgtccgagggtgctcttatttttacagttaccctgca
gtttgtgaatttttgcagaataataatttgttatcaataatcagagcccatgaagcccaa
gatgctgggtatcgaatgtacaggaagagccaaacaacaggctttccatcactcattaca
attttctctgcccccaattacctagatgtctataacaataaagctgctgtgttaaagtat
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aactttatggatgttttcacatggtctttgccttttgttggggaaaaagtcacagagatg
ctggttaacattctcaacatatgctctgatgacgaattgatttccgaagacgaaattgaa
ggcggcactacggttcgaaaggagatcatcaagaataaaatcagagccattgggaagatg
gcacgggtcttttcaattcttcgggaagaaagtgagagtgtgctgactctcaaaggcctg
acccctacaggtaccctccctctgggtgtcctctcaggaggaaagcagactattgagaca
gccacagtagaagccgtagaggcccgggaagctatcagagggttttcgcttcagcacagg
atccggagttttgaagaagcccgaggtctggaccgaattaatgagcggatgccaccccga
aaagacagccagtactccgacgggccagtgaaattggtaacccctgtacaatcaaacgct
gcgctcagaagtgacaagggaagaaaaaccagcagtgactcagagcccagctgtggcaca
ggtggacccaaaacttaa

DBGET integrated database retrieval system