KEGG   Pteropus alecto (black flying fox): 102880203
Entry
102880203         CDS       T02993                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01523  Antifolate resistance
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04062  Chemokine signaling pathway
pale04064  NF-kappa B signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04380  Osteoclast differentiation
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04622  RIG-I-like receptor signaling pathway
pale04623  Cytosolic DNA-sensing pathway
pale04625  C-type lectin receptor signaling pathway
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04668  TNF signaling pathway
pale04920  Adipocytokine signaling pathway
pale05132  Salmonella infection
pale05135  Yersinia infection
pale05142  Chagas disease
pale05145  Toxoplasmosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05212  Pancreatic cancer
pale05215  Prostate cancer
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05222  Small cell lung cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05340  Primary immunodeficiency
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102880203 (IKBKG)
   04014 Ras signaling pathway
    102880203 (IKBKG)
   04064 NF-kappa B signaling pathway
    102880203 (IKBKG)
   04668 TNF signaling pathway
    102880203 (IKBKG)
   04151 PI3K-Akt signaling pathway
    102880203 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102880203 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102880203 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102880203 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102880203 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102880203 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102880203 (IKBKG)
   04660 T cell receptor signaling pathway
    102880203 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    102880203 (IKBKG)
   04659 Th17 cell differentiation
    102880203 (IKBKG)
   04657 IL-17 signaling pathway
    102880203 (IKBKG)
   04662 B cell receptor signaling pathway
    102880203 (IKBKG)
   04062 Chemokine signaling pathway
    102880203 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102880203 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102880203 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102880203 (IKBKG)
   05203 Viral carcinogenesis
    102880203 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102880203 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102880203 (IKBKG)
   05221 Acute myeloid leukemia
    102880203 (IKBKG)
   05220 Chronic myeloid leukemia
    102880203 (IKBKG)
   05215 Prostate cancer
    102880203 (IKBKG)
   05222 Small cell lung cancer
    102880203 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    102880203 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102880203 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102880203 (IKBKG)
   05135 Yersinia infection
    102880203 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102880203 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    102880203 (IKBKG)
   05162 Measles
    102880203 (IKBKG)
   05164 Influenza A
    102880203 (IKBKG)
   05161 Hepatitis B
    102880203 (IKBKG)
   05160 Hepatitis C
    102880203 (IKBKG)
   05168 Herpes simplex virus 1 infection
    102880203 (IKBKG)
   05163 Human cytomegalovirus infection
    102880203 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102880203 (IKBKG)
   05169 Epstein-Barr virus infection
    102880203 (IKBKG)
   05165 Human papillomavirus infection
    102880203 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102880203 (IKBKG)
   05142 Chagas disease
    102880203 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102880203 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102880203 (IKBKG)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102880203 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10
Other DBs
NCBI-GeneID: 102880203
NCBI-ProteinID: XP_006904856
LinkDB
Position
Unknown
AA seq 419 aa
MSRPPWKSQPCEMVQPSGGPAGDQDMLGEEPSLGKPAMLHLPSEQGAPETFQRCLEENQE
LRDAIRQSNQMLRECCEELQRFQGNQREEKQFLMQKFQEARKLVERLSVEKLDLREQREQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQNQSMDAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHMKSSMVSSERNRGTQLEELKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSRLKASCQESARIEDMRKRH
VEVSQPPLAPAPAHHSSHLVLPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtcagccgtgtgagatggtgcagcccagtggtggcccg
gctggggaccaggacatgctgggtgaagagccttctctggggaagccggccatgctccac
ctgccttcggagcagggcgctcctgagaccttccagcgctgtctggaggagaatcaagag
ctccgagatgccattcgccagagcaaccagatgctgcgggagtgctgtgaggagctgcag
cgtttccaaggcaaccagagggaggagaagcagttcctcatgcagaagttccaggaggcc
aggaaactggtggagagactgagtgtggagaagctcgacctgagggagcagagggagcag
gccctgcaggaggtggagcacctgaagaggtgccagcagcagatggccgaggacaaggcc
tcggtgaaagcccaggtgacatcgttgctgggggagctccaggagagccagagtcgcctg
gaagctgccaccaaggagcggcaggctttggagggcagggcccgggcggccagcgagcag
gcccggcagctggagagcgagcgcgaggccctgcagcagcagcacagtgtgcaggtggac
cagctgcgcatgcagaaccaaagcatggacgcagccctgcgcatggagcgccaggccgcc
tcggaggagaagcggaagctggctcagctgcaggtggcctatcaccagctcttccaagag
tatgacaaccacatgaagagcagcatggtgagcagtgagcgaaaccgaggaacgcagctg
gaagagctcaagcagcagctgcagcaggccgaggaggccctggtggccaaacaggaagtg
atcgacaagctgaaggaagaggccgagcagcacaagattgtgatggagaccgtgccggtg
ctgaaggcccaggcggatatctacaaggcagacttccaggccgagaggcaggcccgggag
aagctggccgagaagaaggagctcctgcaggaacagctggagcagctgcagcgggagtat
agcaggttgaaggccagctgtcaggagtcggccaggattgaagatatgaggaagcggcat
gtagaggtctcccagccccccttggcccctgccccagctcaccactcctctcacctggtc
ctgcccagccagaggagaagcccccccgaggagccgcctgacttctgttgccccaagtgc
cagtatcaggctcctgatatggacaccctgcagatacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system