KEGG   Pteropus alecto (black flying fox): 102880226
Entry
102880226         CDS       T02993                                 

Gene name
STAM
Definition
(RefSeq) signal transducing adapter molecule 1
  KO
K04705  signal transducing adaptor molecule
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04144  Endocytosis
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102880226 (STAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102880226 (STAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102880226 (STAM)
Membrane trafficking [BR:pale04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    102880226 (STAM)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10
Other DBs
NCBI-GeneID: 102880226
NCBI-ProteinID: XP_006907051
LinkDB
Position
Unknown
AA seq 544 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSNLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGMGLFPSNFVTADLTXXXXXXXXEMVKTEKKTVQFSDDVQVETIEP
EPEQAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHS
ELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQQYYMQSSGVSAAQVYPGPPQAGTYM
VAGTAQMSHLQSYSLPPEQLSSLSQGAVPPSANPALPSQTQASYPNTMVSSVQGNTYPNQ
ASVYSPPPAAAAAAAAADATIYQNAGTNMSHVPNYNLTSSTLPQPGGSQPPPQPQQPYSQ
KALL
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgcctctctttgccaccaatcccttcgatcaagatgttgagaaagcaaccagtgagatg
aatactgctgaggattggggcctcatcttggatatttgtgataaagttggtcagtctcgt
actggacctaaagattgtcttcgttctattatgaggagggtgaaccataaagatcctcat
gttgctatgcaggctctgactcttctaggagcatgtgtttcaaactgtggcaaaattttt
catttggaagtatgttcaagagattttgctagtgaagtaagcaacgtattaaacaagggt
catcctaaagtgtgtgaaaaattaaaggctcttatggttgaatggacggatgaatttaag
aatgatccacagcttagtctaatatcagcaatgattaaaaatcttaaggaacaaggagtt
acttttccagctattggctctcaggctgcagaacaagcaaaagcaagcccagctctggta
gccaaggatcctggtactgtggctaacaaaaaagaagaagaagatttagcaaaagccatt
gaattgtccctgaaggaacaaaggcagcagtcaaccaccctttccactttgtatccaagc
acatctaacctcttaactaaccaccaacatgaaggccgaaaagttcgtgctatatatgac
tttgaagctgctgaagataatgaacttacttttaaagctggagaaattattacagttctt
gatgacagtgatcccaactggtggaaaggtgaaacccatcaaggcatggggttatttccc
tctaattttgtgactgcagatctcactnnnnnnnnnnnnnnnnnnnnnnntgagatggtt
aaaacggagaagaagacggtacaatttagtgatgatgttcaggtagaaacaatagagcca
gagccggaacaagcctttattgatgaagataaaatggaccaattgctacagatgttacag
agtacagatcccagtgatgatcagccagatcttccagagttacttcatcttgaagcaatg
tgtcaccagatgggacctctcattgatgaaaagctggaagatatcgatagaaaacattca
gaactctcagaacttaatgttaaagtgatggaggcactttcactgtacaccaagttaatg
aatgaagacccaatgtattccatgtatgcaaaattacagaatcagcagtattatatgcag
tcatctggtgtttctgctgctcaggtgtatccagggcctcctcaagctggtacctacatg
gttgcaggaactgcccaaatgagccatctccagagctacagtcttcccccggagcaactg
tcttctctcagccaaggagctgttccaccatctgcgaacccagcccttcctagtcagact
caggcttcttaccctaacacgatggtcagttctgttcaaggaaatacatatcccaaccag
gcttcagtatacagccctcctcctgctgctgctgctgctgctgctgctgctgatgccact
atataccagaatgcaggaactaatatgtcccatgtgcccaactataatttaacatcatca
acgctgcctcagccaggaggcagccaaccgccacctcaaccgcagcaaccatattctcag
aaggctctgctatag

KEGG   Pteropus alecto (black flying fox): 102897126
Entry
102897126         CDS       T02993                                 

Gene name
STAM2
Definition
(RefSeq) signal transducing adapter molecule 2 isoform X1
  KO
K04705  signal transducing adaptor molecule
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04144  Endocytosis
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102897126 (STAM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102897126 (STAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102897126 (STAM2)
Membrane trafficking [BR:pale04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    102897126 (STAM2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT ENTH
Other DBs
NCBI-GeneID: 102897126
NCBI-ProteinID: XP_006921135
LinkDB
Position
Unknown
AA seq 524 aa
MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEICSRDFATEVRAVIKNKAHPKVCDKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGITFPPAGSQTVAAAAKNGTSSNKNKEDEDIAKAIELSLQE
QKQQHTETKSLYPPAEVPLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWW
KGENHRGIGLFPSNFVTTNLNIESEAAAVDKLNVIDDEEEEIKKSEPEPVYIDEDKMDRA
LQVLQSIDPTDAKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALEL
YNRLVNEAPVYSVYSKLHPPAHYPPSAAVPMQTYPIQAHGGNYMGQGIHQVAVAQSYSLG
PDQIGSLRSLPPNVNSSVTAQPAQAPYLSPGQDTVSNPTYMNQNSNLQSATGAAAYTHQM
GMSVDMSSYQNTTSNLPQLAGFPVAVPAHSVAQQQTNYHQQPLL
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgcctctgttcaccgccaaccccttcgagcaagacgtggaaaaagccacaaatgagtat
aacactacagaagattggagtcttattatggacatatgtgacaaagttggaagcacacct
aatggagcaaaagattgcctaaaagccataatgaaaagggtaaatcataaggttcctcat
gttgctctgcaggcattaacccttcttggggcttgtgtggcaaactgtggaaagatattt
catttagaaatatgttcccgtgattttgcaacggaagtacgtgctgtgataaaaaataag
gctcatcctaaagtatgtgataaactgaaatctttaatggtggagtggtcagaagaattt
caaaaggaccctcagtttagtctaatatctgcaactattaaatctatgaaagaagaagga
attacttttcctccagcaggttctcagactgttgcagctgctgccaagaatggtacgtca
tcgaacaaaaacaaagaagatgaagacatagctaaagctatcgaattatcgttgcaagag
cagaagcagcagcacacagaaacaaaatccttatatccacctgcagaagttccattaaat
aataaagttgcaaggaaagtgagagctttatatgattttgaagctgtcgaggacaatgaa
ctcacctttaaacatggtgaaattattattgttttggatgacagtgatgccaattggtgg
aaaggagaaaatcacagaggaataggactcttcccatctaattttgtaacaactaattta
aacatagagtctgaggcagcagctgtggacaaattgaatgtaattgatgatgaggaggag
gaaattaagaaatcggagcctgagcctgtttatatagatgaggataagatggatagagcc
ctgcaggtactccagagtatagatccaactgatgcaaaaccagactcccaagacctcttg
gacttagaagatatctgccaacagatgggtccaatgatagatgaaaaacttgaagagatt
gataggaagcattcagaattgtctgaattgaacgtaaaagtcttggaagctctggaacta
tataacagattggtgaacgaagcaccagtgtattcagtctattcaaagctccatcctcca
gctcattacccaccttcagctgcggttccaatgcagacatacccaattcaggcgcatggt
ggaaattacatgggtcaaggcattcaccaagtcgctgttgcccaaagctacagtttagga
ccagatcagattggttcactgagatctctgcctccaaatgtgaattcctcagtgacagca
caacctgctcaagctccatatttaagccctggacaagacactgtttccaatcctacttat
atgaaccagaactctaatcttcaatcagctactggtgcagctgcttacacacatcagatg
gggatgtctgtggatatgtcctcttaccagaacactacttccaatttgccgcaattggca
ggctttccagtggcagttccagctcattcagttgcacagcagcaaacaaattaccatcag
cagcctctcctttag

DBGET integrated database retrieval system