KEGG   Pteropus alecto (black flying fox): 102880365
Entry
102880365         CDS       T02993                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1 isoform X1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04151  PI3K-Akt signaling pathway
pale04217  Necroptosis
pale04380  Osteoclast differentiation
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04621  NOD-like receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale05140  Leishmaniasis
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05212  Pancreatic cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102880365 (JAK1)
   04151 PI3K-Akt signaling pathway
    102880365 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102880365 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102880365 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102880365 (JAK1)
   04658 Th1 and Th2 cell differentiation
    102880365 (JAK1)
   04659 Th17 cell differentiation
    102880365 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102880365 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102880365 (JAK1)
   05203 Viral carcinogenesis
    102880365 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102880365 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102880365 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102880365 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102880365 (JAK1)
   05161 Hepatitis B
    102880365 (JAK1)
   05160 Hepatitis C
    102880365 (JAK1)
   05171 Coronavirus disease - COVID-19
    102880365 (JAK1)
   05164 Influenza A
    102880365 (JAK1)
   05162 Measles
    102880365 (JAK1)
   05168 Herpes simplex virus 1 infection
    102880365 (JAK1)
   05163 Human cytomegalovirus infection
    102880365 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102880365 (JAK1)
   05169 Epstein-Barr virus infection
    102880365 (JAK1)
   05165 Human papillomavirus infection
    102880365 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102880365 (JAK1)
   05140 Leishmaniasis
    102880365 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102880365 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102880365 (JAK1)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102880365 (JAK1)
Protein kinases [BR:pale01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102880365 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 RIO1 SH2
Other DBs
NCBI-GeneID: 102880365
NCBI-ProteinID: XP_006919342
LinkDB
Position
Unknown
AA seq 1156 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVLFYLSDREPLRLGSGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRTITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMIKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENELN
WFHPNDSGNVLYYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLENKQKKDEEKNKIR
EEWSNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKAEVLGGQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIMQGEHLGRGTRTHIYSGT
LVDYKDDEGISEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKLKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLNQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEIYQLMRKCWEFHPSNRTT
FQNLIEGFEALLKLAA
NT seq 3471 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgcgg
agctccaagaagaccgaggtgaatctggaagcccctgagccaggggtggaagtgctcttc
tatctgtcggatagggagcccctccggctgggcagtggagagtacactgcagaggagcta
tgcatccgggcggcacaggaatgctgtatctctcctctgtgtcacaacctttttgccttg
tatgatgagaacaccaagctctggtatgccccaaatcgcaccatcactgtcgacgataag
acttcgcttcggctccactatcggatgaggttctattttaccaactggcatgggaccaat
gataatgagcagtcagtatggcgacattctccaaagaagcagaaaaatggctatgagaaa
aaaaaagttccagatgcaactcctctccttgacgccagctccctggagtatctgtttgct
cagggacagtatgacttggtcaaatgcctggctccaatccgagaccccaagactgagcag
gatgggcatgacatagagaacgagtgtctggggatggctgtcctggccatctcccattat
gccatgataaagaagatgcagttgccagaactccccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgaggata
aataatgtcttcaaggatttcctaaaggaatttaacaacaagaccatttgtgacagcagt
gtgtccacacatgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggtgctgaaatatttgagacttccatgttactgatttcatcagaaaatgagctgaat
tggtttcatccaaatgacagtggaaatgttctctactatgaagtgatggtgactggaaat
cttggaatccaatggaggcagaaaccaaatgttgttcctgtcgaaaaggaaaaaaataaa
ctgaaacggaaaaaactggaaaataaacagaagaaagatgaggagaaaaacaaaatccgg
gaagagtggagcaatttttcttacttccctgaaatcactcatattgtaataaaggaatct
gtggtcagcattaataagcaagacaacaaaaaaatggaactgaagctctcttcgcacgag
gaggccttgtcttttgtgtccctggtagatggctactttcggctcacagcagacgcccat
cattacctttgcaccgatgtggctcccccactgatcgtccacaacatacagaatggctgt
catggtccaatctgcacagaatatgccatcaataaattgcggcaagaaggaagcgaggag
gggatgtacgtgctgcggtggagctgcactgacttcgacaacatcctcatgaccgtcacc
tgctttgaaaaggctgaggtgctgggtggccagaaacagttcaagaactttcagatcgag
gtgcagaagggtcgctacagtctgcacggttcggaccgcagcttccccagcctgggagac
ctcatgagccacctcaagaagcagatccttcgcacagacaacatcagctttgtgttgaag
cgctgctgccagcccaagccccgagaaatctccaatctgctggtggctactaagaaagcc
caggagtggcagcccgtctaccccatgagccagctgagtttcgatcggatcctcaagaaa
gacattatgcaaggcgaacaccttgggagaggcacgcggacacacatctactctgggacc
ctggtggattacaaggatgacgaaggaatatctgaagagaagagaataaaagtgatcctc
aaagtcttagatcccagccacagagacatttctctggccttctttgaggcagccagcatg
atgagacaggtctcccataaacacatcgtgtacctctatggcgtctgtgtccgagacgtg
gagaatatcatggtggaagagtttgtggagggagggcccctggatctcttcatgcaccgg
aaaagtgatgtcctcaccacaccatggaagctcaaagttgctaaacagttggccagtgcc
ttgagttacttggaggataaagacctggtccacggaaacgtgtgcacgaaaaacctcctc
ctggctcgtgagggcatcgacagtgagtgtggcccattcatcaagctcagtgaccccggc
atccccatcactgtgctgtccaggcaagagtgcatagaacgaatcccgtggattgctcct
gagtgtgtcgaagactccaagaacctgagcgtggccgctgacaagtggagctttggaacc
acactctgggaaatctgttacaacggcgagatccccctgaaagacaagacgctgatcgag
aaagagagattctacgaaagccggtgcaggccagtgacaccatcttgtaaggagctggct
gaccttatgactcgctgcatgaactatgaccccaaccagagaccctttttccgagccatc
atgagagacatcaataagctggaagagcagaatccagacattgtttcagaaaaaaagcca
gcaactgaagtggaccccacacattttgaaaagcggttcttgaagaggatccgtgacttg
ggagagggccactttgggaaagttgagctctgcaggtatgaccctgaaggggacaataca
ggagagcaggtggctgtcaaatccctgaagcctgagagcggaggtaaccacatagctgat
ctgaagaaggaaattgaaatcttaaggaacctctatcacgagaacattgtgaagtacaaa
ggcatctgcacagaagatggaggaaatggtattaagctcatcatggaatttctgccttca
ggaagcctgaaggaatatcttccaaagaataagaacaaaattaacctcaaccagcagtta
aaatatgccgttcagatttgtaaggggatggactatttgggttcacgacaatacgtccac
cgagacttagcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaatcggagac
tttgggttaaccaaagcaatcgaaaccgataaggagtactacacagtcaaggatgatcgg
gacagccctgtgttttggtacgctccagaatgtttaattcagtgtaaattttatatcgcc
tctgacgtctggtctttcggagtgactctgcacgagctgcttacttactgtgattcagat
tccagtcccatggcgttgttcctgaaaatgataggccccactcatggccagatgacagta
acaagacttgtgaatacattaaaagaaggaaaacgtttgccttgtccacctaactgtcca
gatgagatttatcaacttatgagaaaatgctgggaattccacccatctaatcggacaacc
tttcagaaccttatcgaaggatttgaagcacttttaaaattagcagcatga

KEGG   Pteropus alecto (black flying fox): 102882079
Entry
102882079         CDS       T02993                                 

Gene name
JAK2
Definition
(RefSeq) tyrosine-protein kinase JAK2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04062  Chemokine signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04217  Necroptosis
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04630  JAK-STAT signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04725  Cholinergic synapse
pale04917  Prolactin signaling pathway
pale04920  Adipocytokine signaling pathway
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale05140  Leishmaniasis
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05164  Influenza A
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05200  Pathways in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102882079 (JAK2)
   04151 PI3K-Akt signaling pathway
    102882079 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102882079 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102882079 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102882079 (JAK2)
   04659 Th17 cell differentiation
    102882079 (JAK2)
   04062 Chemokine signaling pathway
    102882079 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102882079 (JAK2)
   04917 Prolactin signaling pathway
    102882079 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    102882079 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    102882079 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102882079 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102882079 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102882079 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102882079 (JAK2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102882079 (JAK2)
   05164 Influenza A
    102882079 (JAK2)
   05168 Herpes simplex virus 1 infection
    102882079 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102882079 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102882079 (JAK2)
   05140 Leishmaniasis
    102882079 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102882079 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102882079 (JAK2)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102882079 (JAK2)
Protein kinases [BR:pale01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102882079 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kinase-like RIO1 APH
Other DBs
NCBI-GeneID: 102882079
NCBI-ProteinID: XP_006918443
LinkDB
Position
Unknown
AA seq 1132 aa
MEMACLTMTEMEGTSMSPVHQNGDIPGNANSVKQIDSVLQVYLYHSLGKTEGDYLKFPSG
EYVAEEICVAASKACGITPVYHSMFALMNETERMWYPPNHVFHVDDSARHNVLYRIRYYF
PYWYCNGSNRTYRHGISRGAEAPLLDDFVMSYLFAQWRHDFLHGWIKVPVTHETQEECLG
MAVLDMMRIAKEKDQTPLDIYSSVSYKTFLPKCVRAKIQEYHILTRKRIRYRFRRFIEQF
SHCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSR
GKRKESETLTEQDLQLYCDFPDIIDVSIKQANQEVSNESRIVTIHKQDGKNLEVELNSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPTVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCNPKDFNKYFLTFAVERENVIEYKHCLITKNENGEYNLNGTKKNFSNLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGISDVPTSPTLLRHNNVNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWA
MHFLEEKTLFHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKSLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYVIMTECWNNNVNQRPSFRHLALRVDQIRDSMAG
NT seq 3399 nt   +upstreamnt  +downstreamnt
atggaaatggcttgccttacaatgacggaaatggaaggaacatccatgtctcctgtacat
cagaatggtgatattcctggaaatgccaattctgtgaagcaaatagactcagttctacag
gtgtatctttatcattcccttgggaaaactgagggcgattacctgaagtttccaagtggg
gagtatgttgcagaagaaatttgtgttgctgcttctaaagcctgtggaatcacacctgtg
tatcatagtatgtttgctttaatgaatgaaacagaaaggatgtggtatccacccaaccat
gtcttccatgtagatgactcagccagacataatgtactctacagaataagatattacttt
ccttactggtattgtaatggcagcaacagaacctatcgacatggaatatctcgaggtgct
gaagctcctcttcttgacgactttgtcatgtcgtacctttttgctcagtggcgtcatgat
tttttgcatggatggataaaagtacctgtgactcatgaaacacaggaagaatgtcttggg
atggcagtgttagatatgatgagaatagctaaagaaaaggatcaaaccccactggacatc
tatagctctgtcagctacaagacattcttaccaaaatgtgttcgagcaaagatccaagaa
tatcatattttgacaaggaaaagaataaggtacagatttcgcagatttattgagcaattc
agccattgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaact
cttcagtctgccttctacacagagcaatttgaagtaaaagaacctggaagaggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacgtaaagaaagtgagacactgacagaacaggatttacagttatattgtgatttt
cctgatattattgatgtcagtattaagcaggcaaaccaggaagtctcaaatgaaagcaga
attgtcactatccataagcaagatggtaaaaatctggaagttgaacttaactcattaaga
gaagctttgtcttttgtgtcattaattgatggatattatagattaactgcagatgcacat
cattacctctgtaaagaagtagcgcctccaacggtgcttgaaaatatacaaagcaactgt
catggcccaatttcaatggattttgccatcagtaaactgaagaaagcaggtaatcagact
ggactctatgtacttcgatgcaatcctaaggactttaataaatattttttgacttttgct
gtagagcgagaaaatgtcattgaatataagcattgtttgattacaaaaaatgaaaatgga
gaatacaacctaaacggaactaagaagaacttcagtaatcttaaagatcttttgaattgc
taccagatggaaactgttcgctcagacaatataattttccagtttacgaaatgctgtccc
ccaaagccaaaagataaatcaaaccttctagtctttagaaccaatggtatttctgatgta
ccaacctcaccaacattattgaggcataataacgtgaaccaaatggtttttcacaaaatt
agaaatgaagatttgatatttaatgaaagccttggccaaggcacttttacaaaaattttt
aaaggtgtaagaagagaagtgggagactatggtcaactgcatgaaacagaagtcctttta
aaagttctggataaagcacatagaaactattcagagtctttctttgaagcagcaagtatg
atgagccagctttctcacaagcatctggttttaaattatggagtatgtgtctgtggagag
gagaatattctggttcaggagtttgtgaaatttggatcattagacacatatttgaaaaag
aataaaaattctataaatatattatggaaacttgaagtggctaaacagttggcatgggcc
atgcattttctagaagaaaaaaccctttttcatgggaatgtgtgcgccaaaaatattcta
cttatcagagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatcct
ggcattagtattacagttttgccaaaggacattcttcaagagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaagtctaaacttggcaacagacaaatggagttttggt
accactttgtgggaaatctgcagtggaggagataagcctctcagtgctttggattctcaa
agaaaactacagttttatgaagataggcaccagcttcctgcaccaaagtggacagaatta
gcaaatcttattaataattgtatggattatgaaccagattttagaccttctttcagagcc
attatacgagatcttaatagtttgtttactccagattatgaactattaacagaaaatgac
atgctaccaaatatgaggataggtgccctggggttttctggtgcttttgaagaccgagac
cctacacagtttgaagagagacacttgaaatttctgcagcaactaggcaagggtaatttt
gggagtgtggagatgtgccggtatgaccctctacaagacaacactggggaggtggtggct
gtgaaaaagctccagcacagcactgaagagcacctcagagattttgaaagggaaattgaa
atccttaaatctctacagcatgacaacattgtaaagtacaagggagtgtgctacagtgct
ggccggcgtaacctaagattaattatggaatatttaccatatggaagtttacgagactat
cttcaaaagcataaagaacggatagatcataaaaaacttctgcagtacacatctcaaata
tgcaagggtatggagtatcttggtacaaaaaggtatatccacagggatctggcaacaagg
aatatattggtggagaatgaaaacagagttaaaattggagattttgggttaaccaaagtc
ttgccacaagacaaagaatactataaagtgaaagaacctggtgaaagtcccatattctgg
tatgctccagaatcactgacagagagcaagttttctgtggcctcagatgtttggagtttt
ggagtagttctttatgaacttttcacatatattgagaagagtaaaagtcctccagcggaa
ttcatgcgtatgattggcaatgacaaacaagggcagatgattgtatttcatttgatagaa
ctcctgaagaataatggaagattaccaagaccagatggatgcccagatgagatttatgta
atcatgacagaatgctggaacaataatgtaaatcaacgcccctctttcagacacctcgct
cttcgagttgatcaaataagggacagcatggctggataa

KEGG   Pteropus alecto (black flying fox): 102895629
Entry
102895629         CDS       T02993                                 

Gene name
TYK2
Definition
(RefSeq) non-receptor tyrosine-protein kinase TYK2 isoform X1
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04217  Necroptosis
pale04380  Osteoclast differentiation
pale04621  NOD-like receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale05145  Toxoplasmosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102895629 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102895629 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102895629 (TYK2)
   04658 Th1 and Th2 cell differentiation
    102895629 (TYK2)
   04659 Th17 cell differentiation
    102895629 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102895629 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    102895629 (TYK2)
   05160 Hepatitis C
    102895629 (TYK2)
   05171 Coronavirus disease - COVID-19
    102895629 (TYK2)
   05164 Influenza A
    102895629 (TYK2)
   05162 Measles
    102895629 (TYK2)
   05168 Herpes simplex virus 1 infection
    102895629 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102895629 (TYK2)
   05169 Epstein-Barr virus infection
    102895629 (TYK2)
   05165 Human papillomavirus infection
    102895629 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102895629 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102895629 (TYK2)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102895629 (TYK2)
Protein kinases [BR:pale01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102895629 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kinase-like APH Kdo
Other DBs
NCBI-GeneID: 102895629
NCBI-ProteinID: XP_015453872
LinkDB
Position
Unknown
AA seq 1183 aa
MPLYHWGATARGSRPDGDGTQLTATRGGLKVFLHWAGPDGGEPWVTFSEATLTAEDVCMH
IAHKVGITPPCFSLFALFDAQAQVWLPPNHILEVSRDTSLTLHFRMRFYFRNWHGTNPQE
PAVYRCRPPGAKASSEQAEQGMRLLDPASFEYLFEQGKHEFVNDVASLWDLSNEEEIHHF
KNESLGMAFLHLCHLAVCLGVPLKKVARKISFKDCIPRSFRQQIQQHNAFTQLRLWIIFH
KFLWAFQPGHLSQQVIMVKYLATLERLAPRFGSECVPVCHLELLAQAKGKPCYVEDSSQA
PPDPGPESAPGPPTHEVLVTGTGGIRWRPAPAEGPSGGDGGRRRNPHAGSSGKKIKAQES
VTQPVDRLQEAPWTYFCDFQDITHVVLRECHVSIHCQDKCLKLTLPSRAMALSLVSLVDG
YFRLTADSNHYLCHEVAPPRLVMSIQDGVHGPLLEPFVLAKLRPEDGLYLIHWSTSHFNR
LILTVAQKDQAPGGQCLRLRKFPIELHAGTFTLESWDRSFPSVRELRAALQGYLLRAGDD
CFSLRHCCLPQPGEISNLIIRWGPEASTKPLSLSQLSFHRVCQDDITQLSHLGQGTRTNV
YEGLLRVGDRGPEEDKADGGDSPTAGRGHGQELRVVLKVLDPSHHGIALAFYETASLMSQ
VSHMHLAFVHGVCVHGSKNIMVAEYVEHGPLDVWLRRERGCVPVAWKVVVAQQLASALSY
LEDKSLVHGNVCGRNILLARPGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLPPECL
SGGANSLSTAADKWGFGATLLEICFNGEAPLQGRSPSEKEHFYQKQYQLPEPSCLELAML
TSQCLTYEPAQRPSFRTILRDLTRLQPQNLVDGLAVTPDCQASDPTVFHKRYLKKIRDLG
EGHFGKVSLYCYDPTNDSTGEMVAVKALKAGCGPQLSTGWRREIDILRTLSHENIVKYKG
CCEDQGEKSVQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHTQHYIHRDL
AARNVLLDNNRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASDV
WSFGVTMYELLTYCDSSQSPPSKFIELIGFTQGQMTVLRLTELLERGERLPRPEKCPCEI
YLLMKKCWKAEASFRPTFQNLIPILKTAHEKYQGQAPSVFSVC
NT seq 3552 nt   +upstreamnt  +downstreamnt
atgcctttgtaccactggggggccacagccaggggcagcaggcctgatggggacggaacc
cagctcacggctaccagaggaggcctgaaggtattcctgcactgggctggccccgatggt
ggagagccctgggtcaccttcagcgaggccacactgactgcagaggacgtctgcatgcac
attgcacacaaagtcggcatcactccaccctgcttcagtctctttgccctcttcgatgcc
caggcccaggtctggctgcccccaaaccacattctagaggtctccagagatacaagcctg
acgctgcacttccgcatgagattttatttccggaactggcatggcacaaatcctcaggag
ccagctgtgtaccgctgcaggcccccaggggccaaggcttcatcagaacaggcagagcag
ggcatgcgactcctggacccagcctcctttgagtacctctttgagcagggcaagcatgag
tttgtgaatgacgtagcatcgctgtgggacctgtcgaacgaggaggagatccaccacttt
aagaatgagagcctgggcatggcctttctgcacctctgccacctcgctgtctgccttggt
gttcccctaaagaaggtggccagaaagatcagcttcaaagactgcatcccgcgctccttc
cggcaacagatccagcaacacaacgcgttcacacaactgcgcctgtggatcatcttccac
aagttcctgtgggccttccagccaggccacctctcccaacaggtcatcatggtcaagtac
ctggccacactcgagcggctggcgccccgctttggctcggagtgcgtgcctgtgtgccac
ctagagctgttggcccaggccaaggggaagccgtgctacgtcgaggatagcagtcaggcc
cctccggaccctgggcccgagtctgctccaggaccccctacccatgaggtgctggtgact
ggcactggtggcatccggtggcggccagcaccggcagagggtcccagtggtggtgatggt
ggcaggagaaggaatccccatgccggctcatctgggaagaaaatcaaggcccaagagtca
gtcacccaacctgtggacaggctgcaggaggcgccatggacctacttctgtgacttccag
gacatcacccacgtagtactgagagaatgccatgtcagtatccactgtcaggacaagtgc
ttgaagctgactctgccttcccgggccatggccctgtccttggtatcactggtggatggc
tatttccgcctgacggccgactcaaaccactacctatgccatgaagtggctcctccacgg
ctggtgatgagtatccaggatggtgtccacggacccctgctggagccattcgtgctggcc
aagctgcgaccagaggatggcctctatctcatccactggagcaccagccacttcaaccgc
ctcatccttacggtggcccagaaagaccaggcacctggcggacagtgcttgcgcctgcgg
aagttccccattgagctgcatgcagggacctttacgctggagagctgggacaggtccttc
cccagtgtgcgtgagcttcgggctgccctgcagggctacttgctgcgggccggtgatgac
tgcttctccctgcgccactgctgcctgccacagccaggagagatctccaacctcatcatc
aggtgggggcctgaggccagcaccaagcctctcagcctcagccagctcagcttccaccgg
gtctgccaggatgacatcacccagctgtcccacttaggccagggcacaaggaccaatgtg
tatgagggcctcctgagagtgggtgacagaggacctgaggaagacaaggcagatggtggg
gattcccccacagcaggcaggggccatgggcaggagctgcgagtggtgctgaaggtgctg
gaccccagccaccatggcatcgccctggccttctacgagacagccagcctcatgagccag
gtatcccacatgcacctggccttcgtccatggcgtctgcgtgcatggctccaagaacatc
atggtggcagagtacgtggaacatggacccctagatgtgtggctgcggcgggagaggggc
tgcgtccctgtggcctggaaggtggtggtggcccagcagctggccagtgccctcagttac
ctggaagacaagagcctggtgcacggtaatgtgtgtggccggaacatcctgctggcacgt
ccagggttggcggagggcaccagcccattcatcaagctgagcgaccccggcgtgggcctg
ggtgccctctccagggaggaacgggtagagcggatcccctggctgcccccggagtgcctg
tctggtggggccaacagcctcagcacagcagctgacaagtggggttttggcgccaccctc
ctggagatctgcttcaacggggaggctcccctgcaaggccgcagcccctccgagaaagag
cacttctaccagaagcagtaccagctgcctgaaccctcgtgcctggagctggccatgctt
accagccagtgcctgacctatgagccagcccaacggccgtccttccgcaccatcctgcgt
gacctcactcggctgcagcctcaaaatcttgttgatggcttggctgtgactccagactgt
caggcgtcagaccccactgttttccacaagcgctatttgaaaaagatccgggatctgggc
gagggtcactttggcaaggtcagcctgtactgctacgacccgaccaatgacagcactggc
gagatggtggccgtgaaggcccttaaggcgggctgcggcccccagctcagcaccggctgg
aggcgggagatcgacatcctgcgcacgctctctcacgagaacatcgtcaaatacaagggg
tgctgcgaggaccaaggcgagaaatcagtgcagctcgtcatggagtacgtgcccctgggc
agcctccgagactacctgccccggcacagcgttggcctggcccagctgctgctgtttgct
cagcagatctgcgagggcatggcctacctgcacacgcagcactacatccaccgagacctg
gctgcgcgcaacgtgctgctggacaacaataggctggtcaagattggcgatttcggccta
gccaaagctgtgcctgaaggccacgagtactaccgcgtgcgagaggatggggacagtcct
gtgttctggtatgccccagagtgcttgaaggagtgtaagttctactatgcatccgacgtc
tggtcctttggggtcaccatgtatgaactgctgacctactgtgactccagccaaagcccc
ccttcgaaatttatcgagcttataggcttcacccaggggcagatgacagtactgaggctc
acagagctgctggagcgaggagagaggctgccgcggccagagaaatgtccctgtgagatc
tatctcctcatgaagaagtgctggaaggcagaggcctcattccgcccaaccttccagaac
ctcatacccatcctgaaaacagcccacgagaaataccagggccaggccccctcggtgttc
agtgtctgctga

KEGG   Pteropus alecto (black flying fox): 102898620
Entry
102898620         CDS       T02993                                 

Gene name
JAK3
Definition
(RefSeq) tyrosine-protein kinase JAK3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04062  Chemokine signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04217  Necroptosis
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04630  JAK-STAT signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale05161  Hepatitis B
pale05162  Measles
pale05166  Human T-cell leukemia virus 1 infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05223  Non-small cell lung cancer
pale05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102898620 (JAK3)
   04151 PI3K-Akt signaling pathway
    102898620 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102898620 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102898620 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102898620 (JAK3)
   04659 Th17 cell differentiation
    102898620 (JAK3)
   04062 Chemokine signaling pathway
    102898620 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102898620 (JAK3)
   05203 Viral carcinogenesis
    102898620 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102898620 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    102898620 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102898620 (JAK3)
   05161 Hepatitis B
    102898620 (JAK3)
   05162 Measles
    102898620 (JAK3)
   05169 Epstein-Barr virus infection
    102898620 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102898620 (JAK3)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102898620 (JAK3)
Protein kinases [BR:pale01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102898620 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kdo APH CARD
Other DBs
NCBI-GeneID: 102898620
NCBI-ProteinID: XP_015441664
UniProt: L5L7Y5
LinkDB
Position
Unknown
AA seq 1104 aa
MVPPSEETPLISQRSCSLSSSEAGVLHVLLPPRGPGPLQRLSFSFGDHSAEELCVRAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDTGTQVLVYRLRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRNDLVSGRFHVGLGLKEQGECLSLAVLDLARMAREQAQR
PEELLKTVSYKACLPPGLRNLIQGLSFVTRRRIRRTVRQALCRVAACQADRHSLMAKYIM
DLERLDPARAAETFLVGLPGVAGGQDAPGLLHVAGDSGIAWSSGEQEVFQPFCDFPEIVD
ISIKQALRVGTAGEHRLVTVTRTDNQILEAEFPGLPAALSFVALVDGYFRLTVDSRHYFC
KEVAPPRLLEEVAQQCHGPITLDFAINKLKMGGSLPGSYVLRRSPQDFDSFLLTVCVQTP
LGPDYKGCLIRCDPTGAYSLAGLGRPHSSLRELLAACWDGGLHVDGVALNLTFCCTPRPK
EKSNLIVVRRGCSPPTSSPVQPHSGCQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEAMDGEPRKTEVLLKVLDAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSIMVQ
EFVHLGALDTYLRKCGQLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
EGSPPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEARTLGLEADKWGFGATVWEVFS
GVTMPISTLDPAKKLQFYEERQQLPAPKWMELALLIQQCMAYEPGHRPSFRAVIRDLNNL
ITSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLGAGRLLLYASQICKGMEYLGSCRCVHRDLAARNILVESE
THVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYSDKSCSPSAEFLRMMGCERDIPALCRLLDLLAEGQRLPAPPACPGEVHELMKLCWAP
SPQDRPTFSALGPQLDALWSGSQG
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggtgcctccgagtgaggagacacccctgatctctcagcgctcttgcagcctctcatct
tcagaggctggtgtgctgcatgtgctgctgccacctcggggccctggacccctgcagcgt
ctatccttctcctttggggaccactcggctgaagagctgtgtgttcgggctgctaaggcc
agtggcatcctgcctgtgtaccactccctctttgctctggccacggaggacctgtcctgc
tggttccccccgagccacatcttctccgtggaggacacaggcacccaagtccttgtctac
aggctccgcttttacttccccaactggtttgggctagagaagtgtcaccgcttcgggctt
cgaaaggacttggctagtgccatccttgacctgccagttctggagcacctcttcgcccag
caccgcaatgacctggtgagcggccgcttccacgtgggccttggcctcaaggagcagggc
gaatgtctcagcttggcagtgctggacctggccaggatggcccgcgagcaggcccagcgg
ccagaggagctgctaaagaccgtcagctacaaggcctgcctgccccctggcctgcgcaac
ctgatccagggcctgagcttcgtgactcggaggcgcattcggaggactgtacgccaggcc
ctgtgccgcgtggccgcctgccaggctgacaggcactcgctcatggccaagtacatcatg
gacttggagcgactggacccggccagggccgctgagaccttcctcgtgggcctccccggg
gttgctggtggtcaggatgcaccggggctgctccacgtggctggtgacagcggcatcgcc
tggagttcaggagaacaggaggtcttccagcccttttgcgactttccagaaatcgtggac
atcagcatcaagcaggctctacgcgttggcacggccggggagcaccgcctggtcactgtc
accaggacagacaaccagatcctggaggccgagttccctgggctgcccgccgcgttgtcc
tttgtggcgctcgtggatggctacttccggctgactgttgactctcggcactacttctgc
aaggaggtagcaccgccgcggttgctggaggaggtggcgcagcagtgccatggccccatc
accctggattttgcaatcaacaagctcaagatgggggggtcccttcctggctcctacgtt
ctccgccgcagcccccaggatttcgacagcttcctcctcactgtctgtgttcagaccccc
ctgggccctgattacaagggctgcctcatccggtgtgaccccacaggagcctactccctg
gctggccttggccgaccccacagtagtctgcgagagctcctggcagcctgctgggatggt
gggctgcatgtggatggggttgcactgaaccttaccttctgctgcacccctagacccaaa
gaaaagtccaacctgattgtggtccggagaggttgcagcccacccacatcatcccccgtg
cagccccactcaggatgccagctgagtcagatgacatttcacaagatacctgctgacagc
ttggagtggcatgagaacctgggtcatggatccttcacgaagatttacaggggctgtcgc
cacgaggccatggatggggagccccggaagacagaggtgctgctcaaggtgttggatgcc
aaacacaagaactgcatggagtcattcctggaagcagcaagtttgatgagccaagtatcg
taccagcatctcgtgttgcttcatggcgtgtgcatggctggagacagcatcatggtgcag
gaatttgtacacctgggagcactggacacgtatctacgcaagtgtgggcagctggtgcca
gccagctggaagctgcaggtgatcaaacagctggcctatgccctcaactatctggaggac
aaaggccttccccatggcaatgtctcagcccggaaggtgctcctggctcgggaaggggct
gaggggagcccgcccttcatcaagctgagtgatcccggtgtcagccccactgtactaagc
ctggagatgctcactgacaggatcccctgggtagctcctgagtgtctccaggaggcccgg
acacttggcttggaagctgacaagtggggcttcggtgccacagtctgggaggtgttcagt
ggtgtcacgatgccaatcagtaccctggatcctgccaagaagctccagttttatgaggaa
cggcagcagctgcctgcccccaagtggatggagctggccctgctgatccaacagtgcatg
gcctacgagccaggccacaggccctccttccgcgccgtcatccgtgacctgaacaacctt
atcacgtcagactatgagctcctctcagaccccacacctggtgccttggcaccccgtgac
gggctgtggaatggcgcccagctctatgcctgccaggaccctactatctttgaggagaga
cacctgaagtatatctcacagctgggcaagggtaactttggcagcgtggaactatgtcgc
tatgacccgctgggagacaacacaggtgccctggtggccgtgaagcagctgcagcacagt
gggccagaccagcagagggacttccaacgggagatccagatcctcaaagccctgcacagt
gacttcattgtcaagtaccgtggtgtcagctatggcccaggccgtcagagcctgcggcta
gtcatggagtacctgcccagtggctgcctgagagatttcctgcagcggcaccgcgcacgc
ctcggcgccggccgcctgctcctctatgcttcgcagatctgcaagggcatggagtatctg
ggctcctgccgctgcgtgcaccgcgacctggcagcgcgtaacatcctggtggagagcgag
acgcacgtcaagatcgccgactttggcctcgccaagctgctgccgctggacaaagactat
tacgttgtccgcgagccaggccagagccccattttctggtacgccccggagtccctctca
gacaacatcttctcgcgccagtcggacgtctggagcttcggagtcgtcctgtacgagctt
ttcacctacagtgacaagagctgcagcccctccgccgagttcctgcggatgatgggttgt
gagcgagatatcccggctctttgccgcctcctggacctgctggcagagggccagaggctg
ccggcgcctccagcctgccctggagaggttcatgagctcatgaagctgtgctgggctcct
agcccgcaagaccggccgaccttcagtgccctcggaccccagctggatgcgctgtggagt
ggaagccaggggtag

DBGET integrated database retrieval system