KEGG   Pteropus alecto (black flying fox): 102880369Help
Entry
102880369         CDS       T02993                                 

Gene name
AOC1
Definition
(RefSeq) amiloride-sensitive amine oxidase [copper-containing]
  KO
K11182  diamine oxidase [EC:1.4.3.22]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00330  Arginine and proline metabolism
pale00340  Histidine metabolism
pale00380  Tryptophan metabolism
pale01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    102880369 (AOC1)
   00340 Histidine metabolism
    102880369 (AOC1)
   00380 Tryptophan metabolism
    102880369 (AOC1)
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.22  diamine oxidase
     102880369 (AOC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2 Cu_amine_oxidN3 DUF1965
Motif
Other DBs
NCBI-GeneID: 102880369
NCBI-ProteinID: XP_006920689
LinkDB All DBs
Position
Unknown
AA seq 759 aa AA seqDB search
MRREISALGWAVAAILMLQATVTANRPPRSPHSKSSVFADLSAQELKTVRSFLWARKELR
LQPSRASAIAKNSVFLIEMLLPKKHQVLKYLDNGQRRPVREARAIIFFGDQEHPNVTEFA
VGPLPRPRYMRELSPRPRRRISWASRPMSSAEYAQISHALQEATKPLRQFFLDTTGFSFH
DCHTRCLTFTDSAPRGLASGQRRSWFIFQLYVEGHFLHPTGLELCMDHGSTNPQDWTVEH
VWYNGKFYRSPEELARKYSDGEVDAVVLGDPRPWGKGAERMEEPALFSSYRPRGDFSSPV
TDSVHGPRLVQPQGPRYRLEGHAVLYGDWSFAFRLRPTTGLQVLNLLFRGERVAYEVSVQ
EVLVLYGGHTPAGMQTKYLDGGWGLGTLSHELAPGLDCPETATFLDAVHHFDADDPILYP
RALCLFEMPTGVPLRRHFNSNFSGGFNFYAGLEGQVLVLRTTSTVYNYDYIWDFIFYPSG
VMEAKVHATGYVFATFYTPEGLRHGSRLHTHLLGNMHTHLVHYRVDLDVAGTKNGFQTLQ
MKLENITNPWSPTHRLVQPTLEQTKYPRERQAAFRFGRPLPSYLLFSSPQTNPWGHTRTY
RLQIHSMAEQVLPPGWQEERGITWARYPLAVTKYRESELRSSSLYNQNDPWDPPVVFEDF
LRNNENIEDEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNFFPEDPSLASRDT
VIVWPRDNGSNYVQRWIPEEDGDCLMPRPFSYNGTYGPV
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgaggagagagatctcggccctcggctgggccgtcgctgccatcctgatgctacaggcg
acggtcacggccaatcggcccccacggagcccgcacagcaagtccagcgtgtttgcagac
ctgagcgcccaagagctgaagaccgtgcgcagcttcctctgggcccgcaaggagctgagg
ctgcagccgtccagagcatcggccatcgccaagaactccgtgttcctcatcgagatgctg
ctgcccaagaagcaccaagtgctgaaatacctggacaatggtcaaaggcgccccgtgcgg
gaggcgcgtgccatcatcttcttcggggaccaggagcaccccaacgtcaccgagttcgct
gtggggcccctgccacggccccgctacatgcgcgagctgtcccccaggcccaggcgccgg
atctcctgggcctccaggcccatgtcctcggcggagtacgcccaaataagccacgccctg
caagaggccaccaagcccctgcgccaatttttcctcgataccacgggtttctccttccac
gactgccacacccggtgcctgaccttcacggattcggcgccccggggtttggcctcgggt
cagcgtcgcagctggttcatcttccagctctacgtggaaggccacttcctgcaccccacc
ggcctggagctctgcatggaccacggaagcacgaacccccaggattggacggtggagcac
gtctggtacaacgggaagttctaccggagcccggaagaactggcacggaagtacagtgac
ggagaggtggacgcggtggtcctgggggacccccgcccctggggcaagggggcggagcgc
atggaggagcccgccctcttctcctcctacaggccccgcggggacttctccagccccgtc
accgacagcgtgcacgggccccgcctggtccagccccaaggcccccgctaccggctggag
ggccacgccgtgctctacggggactggagcttcgccttccgcctgcggcccaccacgggc
ctgcaggtcctgaacctgctcttccgcggggagcgcgtggcctacgaggtgagcgtgcag
gaggtgctggtgctgtacggaggccacacgccggccggcatgcagaccaagtacttggac
gggggctggggcctgggcaccttatcccacgagctggcccctggcctcgactgcccggag
accgccaccttcctggacgccgtgcaccacttcgacgccgacgaccccatcctctacccc
cgcgccctctgcctcttcgagatgcccacgggggtgcccctccggcggcattttaattcc
aacttcagcgggggcttcaacttctacgcggggctcgagggccaggtgctggtgttgcgg
acgacctccacggtctacaactacgactacatctgggacttcatcttctaccccagcggg
gtgatggaggccaaggtgcacgccaccggctacgtcttcgccaccttctacacccccgag
gggctgcggcacgggtcccgcttgcacacgcacctgctcggcaacatgcacacgcacctg
gtgcactaccgcgtcgacctggacgtggcaggcaccaagaatggcttccagaccctgcag
atgaagctagaaaacatcaccaacccctggagcccgacgcaccgcctggtgcagccgacc
ctagagcagaccaagtaccccagggagcgccaggcggccttccgcttcggacggcctctg
cccagctacctgctcttctccagcccccagacgaacccctggggccacacgcgcacctac
cgcctgcagatccactccatggccgagcaagtcctgccccctggctggcaggaggagagg
ggtatcacctgggccaggtaccccttggcggtgaccaagtaccgggagtctgagctacgc
agcagcagcctctacaaccagaacgacccctgggacccgccggtggtcttcgaggatttc
cttcgcaacaacgagaacatcgaagatgaggacttggtggcctgggtgacagtgggcttc
ttgcacatcccccactcagaggacatccccaacacggccacgccgggaaactccgtgggc
ttcctgctccgacccttcaacttcttcccagaggacccgtccctggcgtccagagacacg
gtgatcgtgtggcctcgggataacggctccaattacgtccagcgctggattcctgaggag
gacggggactgcttgatgccccgcccctttagctacaatgggacctacgggcccgtgtga

DBGET integrated database retrieval system