KEGG   Pteropus alecto (black flying fox): 102880663
Entry
102880663         CDS       T02993                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04062  Chemokine signaling pathway
pale04064  NF-kappa B signaling pathway
pale04066  HIF-1 signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04150  mTOR signaling pathway
pale04270  Vascular smooth muscle contraction
pale04310  Wnt signaling pathway
pale04370  VEGF signaling pathway
pale04510  Focal adhesion
pale04540  Gap junction
pale04613  Neutrophil extracellular trap formation
pale04650  Natural killer cell mediated cytotoxicity
pale04662  B cell receptor signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04670  Leukocyte transendothelial migration
pale04713  Circadian entrainment
pale04720  Long-term potentiation
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04727  GABAergic synapse
pale04728  Dopaminergic synapse
pale04730  Long-term depression
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04925  Aldosterone synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04929  GnRH secretion
pale04931  Insulin resistance
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale04960  Aldosterone-regulated sodium reabsorption
pale04961  Endocrine and other factor-regulated calcium reabsorption
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04973  Carbohydrate digestion and absorption
pale05017  Spinocerebellar ataxia
pale05022  Pathways of neurodegeneration - multiple diseases
pale05031  Amphetamine addiction
pale05032  Morphine addiction
pale05140  Leishmaniasis
pale05143  African trypanosomiasis
pale05146  Amoebiasis
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05214  Glioma
pale05223  Non-small cell lung cancer
pale05225  Hepatocellular carcinoma
pale05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102880663 (PRKCB)
   04012 ErbB signaling pathway
    102880663 (PRKCB)
   04014 Ras signaling pathway
    102880663 (PRKCB)
   04015 Rap1 signaling pathway
    102880663 (PRKCB)
   04310 Wnt signaling pathway
    102880663 (PRKCB)
   04370 VEGF signaling pathway
    102880663 (PRKCB)
   04064 NF-kappa B signaling pathway
    102880663 (PRKCB)
   04066 HIF-1 signaling pathway
    102880663 (PRKCB)
   04020 Calcium signaling pathway
    102880663 (PRKCB)
   04070 Phosphatidylinositol signaling system
    102880663 (PRKCB)
   04071 Sphingolipid signaling pathway
    102880663 (PRKCB)
   04150 mTOR signaling pathway
    102880663 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102880663 (PRKCB)
   04540 Gap junction
    102880663 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102880663 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    102880663 (PRKCB)
   04662 B cell receptor signaling pathway
    102880663 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    102880663 (PRKCB)
   04670 Leukocyte transendothelial migration
    102880663 (PRKCB)
   04062 Chemokine signaling pathway
    102880663 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    102880663 (PRKCB)
   04929 GnRH secretion
    102880663 (PRKCB)
   04912 GnRH signaling pathway
    102880663 (PRKCB)
   04921 Oxytocin signaling pathway
    102880663 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    102880663 (PRKCB)
   04918 Thyroid hormone synthesis
    102880663 (PRKCB)
   04919 Thyroid hormone signaling pathway
    102880663 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    102880663 (PRKCB)
   04916 Melanogenesis
    102880663 (PRKCB)
   04925 Aldosterone synthesis and secretion
    102880663 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102880663 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    102880663 (PRKCB)
   04971 Gastric acid secretion
    102880663 (PRKCB)
   04972 Pancreatic secretion
    102880663 (PRKCB)
   04973 Carbohydrate digestion and absorption
    102880663 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102880663 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102880663 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    102880663 (PRKCB)
   04727 GABAergic synapse
    102880663 (PRKCB)
   04725 Cholinergic synapse
    102880663 (PRKCB)
   04728 Dopaminergic synapse
    102880663 (PRKCB)
   04726 Serotonergic synapse
    102880663 (PRKCB)
   04720 Long-term potentiation
    102880663 (PRKCB)
   04730 Long-term depression
    102880663 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    102880663 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102880663 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102880663 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102880663 (PRKCB)
   05206 MicroRNAs in cancer
    102880663 (PRKCB)
   05205 Proteoglycans in cancer
    102880663 (PRKCB)
   05231 Choline metabolism in cancer
    102880663 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102880663 (PRKCB)
   05214 Glioma
    102880663 (PRKCB)
   05223 Non-small cell lung cancer
    102880663 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    102880663 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    102880663 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    102880663 (PRKCB)
   05032 Morphine addiction
    102880663 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102880663 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102880663 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102880663 (PRKCB)
   05161 Hepatitis B
    102880663 (PRKCB)
   05171 Coronavirus disease - COVID-19
    102880663 (PRKCB)
   05164 Influenza A
    102880663 (PRKCB)
   05163 Human cytomegalovirus infection
    102880663 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102880663 (PRKCB)
   05140 Leishmaniasis
    102880663 (PRKCB)
   05143 African trypanosomiasis
    102880663 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102880663 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102880663 (PRKCB)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     102880663 (PRKCB)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   102880663 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C Kinase-like C1_2 CEP76-C2 APH
Other DBs
NCBI-GeneID: 102880663
NCBI-ProteinID: XP_006912610
LinkDB
Position
Unknown
AA seq 616 aa
RGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDH
CGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRISIKAQIEKEVLTVVV
RDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKD
RRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGGEC
DDDLRQKFERAKIGQAPKTPEEKTTNTTSKCDSNGSGDRMKLTDFNFLMVLGKGSFGKVM
LSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLY
FVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSE
GHVKIADFGMCKENMWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAG
QAPFEGEDEDELFQSIMEHTVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEH
AFFRYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDHEVIRNIDQSEFE
GFSFVNSEFLKPEVKS
NT seq 1851 nt   +upstreamnt  +downstreamnt
aggggcttcgggaagcaaggatttcagtgccaagtctgctgtttcgtcgtgcacaagcgg
tgccatgaatttgtcactttctcctgcccaggcgccgacaagggcccagcctctgatgac
ccccggagcaaacacaagttcaagatccacacgtactccagccccacgttctgcgaccac
tgcgggtccctgctctacgggctcattcaccaagggatgaagtgtgacacctgcatgatg
aacgtccacaagcgctgcgtgatgaacgtgcccagcctctgcggcacggaccacacggag
cgccgcggccgcatctccatcaaggcgcagatcgagaaggaagtcctcaccgtggtcgta
agagatgccaaaaacctcgtccctatggaccccaacggcttgtcagatccctacgtgaag
ctgaaactcattcccgaccccaaaagtgagagcaagcagaagaccaaaaccatcaagtgc
tccctgaaccccgagtggaacgagaccttcagattccagctgaaggaatcggacaaggac
aggaggctgtccgtggagatttgggactgggacctgaccagccggaatgacttcatgggg
tccttgtcgttcgggatctctgagctgcagaaggctggcgtcgatggctggttcaagctt
ctgagccaggaggaaggcgagtacttcaacgtgccggtgccgccggagggcggcgagtgt
gacgacgacctgcgccagaagttcgagagggccaagatcggtcaggcgcccaagaccccg
gaagagaagacgaccaacaccacctccaaatgtgacagcaatggcagcggggaccggatg
aagctgaccgacttcaacttcctgatggtgctcgggaaaggcagcttcggcaaggtcatg
ctctcggagcggaaaggcacggacgagctgtacgccgtgaagatcctgaagaaggacgtg
gtgatccaggacgacgacgtggagtgcacgatggtggagaagcgggtgctggcgctgcct
gggaagccgcccttcctcacccagctgcactcctgcttccagaccatggaccgcctgtac
ttcgtgatggagtatgtgaacggcggggacctcatgtaccacatccagcaggtcggccgg
ttcaaggagcctcacgccgtattctacgccgcagaaatcgccatcggcctgttcttccta
caaagcaagggcatcatttaccgcgacctaaaactcgacaacgtgatgctggactccgag
ggccacgtgaagatcgccgacttcggcatgtgtaaggagaacatgtgggacggcgtgacc
accaagaccttctgcggcactccagactacatcgcccccgagatcatcgcttatcagccc
tacgggaagtcggtggactggtgggctttcggagtcttgctctacgaaatgctggccggg
caggcgccgttcgaaggggaggacgaggacgagctcttccagtccatcatggagcacacc
gtggcctacccgaagtccatgtccaaggaggccgtggccatctgcaaagggctgatgacc
aaacacccaggcaaacgtctgggctgcggacccgaaggcgagcgagacatcaaagaacat
gcattcttccggtacatagactgggagaaactcgaacgcaaagagatccagcccccgtat
aagccgaaagcctgtgggcgaaacgccgaaaacttcgaccggtttttcacccgtcaccca
ccagtcctaacacctcccgaccacgaagtcatcaggaacattgaccaatcagaatttgaa
ggattttcctttgttaactctgaatttttaaaacccgaagtcaagagctaa

KEGG   Pteropus alecto (black flying fox): 102887078
Entry
102887078         CDS       T02993                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04066  HIF-1 signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04310  Wnt signaling pathway
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04510  Focal adhesion
pale04540  Gap junction
pale04613  Neutrophil extracellular trap formation
pale04650  Natural killer cell mediated cytotoxicity
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04670  Leukocyte transendothelial migration
pale04713  Circadian entrainment
pale04720  Long-term potentiation
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04727  GABAergic synapse
pale04728  Dopaminergic synapse
pale04730  Long-term depression
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale04929  GnRH secretion
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale04960  Aldosterone-regulated sodium reabsorption
pale04961  Endocrine and other factor-regulated calcium reabsorption
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale05017  Spinocerebellar ataxia
pale05022  Pathways of neurodegeneration - multiple diseases
pale05031  Amphetamine addiction
pale05032  Morphine addiction
pale05143  African trypanosomiasis
pale05146  Amoebiasis
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05214  Glioma
pale05223  Non-small cell lung cancer
pale05225  Hepatocellular carcinoma
pale05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102887078 (PRKCA)
   04012 ErbB signaling pathway
    102887078 (PRKCA)
   04014 Ras signaling pathway
    102887078 (PRKCA)
   04015 Rap1 signaling pathway
    102887078 (PRKCA)
   04310 Wnt signaling pathway
    102887078 (PRKCA)
   04370 VEGF signaling pathway
    102887078 (PRKCA)
   04066 HIF-1 signaling pathway
    102887078 (PRKCA)
   04020 Calcium signaling pathway
    102887078 (PRKCA)
   04070 Phosphatidylinositol signaling system
    102887078 (PRKCA)
   04072 Phospholipase D signaling pathway
    102887078 (PRKCA)
   04071 Sphingolipid signaling pathway
    102887078 (PRKCA)
   04151 PI3K-Akt signaling pathway
    102887078 (PRKCA)
   04150 mTOR signaling pathway
    102887078 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102887078 (PRKCA)
   04540 Gap junction
    102887078 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102887078 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    102887078 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    102887078 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    102887078 (PRKCA)
   04670 Leukocyte transendothelial migration
    102887078 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    102887078 (PRKCA)
   04929 GnRH secretion
    102887078 (PRKCA)
   04912 GnRH signaling pathway
    102887078 (PRKCA)
   04921 Oxytocin signaling pathway
    102887078 (PRKCA)
   04926 Relaxin signaling pathway
    102887078 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    102887078 (PRKCA)
   04918 Thyroid hormone synthesis
    102887078 (PRKCA)
   04919 Thyroid hormone signaling pathway
    102887078 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    102887078 (PRKCA)
   04916 Melanogenesis
    102887078 (PRKCA)
   04925 Aldosterone synthesis and secretion
    102887078 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102887078 (PRKCA)
   04270 Vascular smooth muscle contraction
    102887078 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    102887078 (PRKCA)
   04971 Gastric acid secretion
    102887078 (PRKCA)
   04972 Pancreatic secretion
    102887078 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102887078 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102887078 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102887078 (PRKCA)
   04727 GABAergic synapse
    102887078 (PRKCA)
   04725 Cholinergic synapse
    102887078 (PRKCA)
   04728 Dopaminergic synapse
    102887078 (PRKCA)
   04726 Serotonergic synapse
    102887078 (PRKCA)
   04720 Long-term potentiation
    102887078 (PRKCA)
   04730 Long-term depression
    102887078 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    102887078 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102887078 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    102887078 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102887078 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102887078 (PRKCA)
   05206 MicroRNAs in cancer
    102887078 (PRKCA)
   05205 Proteoglycans in cancer
    102887078 (PRKCA)
   05231 Choline metabolism in cancer
    102887078 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102887078 (PRKCA)
   05214 Glioma
    102887078 (PRKCA)
   05223 Non-small cell lung cancer
    102887078 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    102887078 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    102887078 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    102887078 (PRKCA)
   05032 Morphine addiction
    102887078 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102887078 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102887078 (PRKCA)
   05161 Hepatitis B
    102887078 (PRKCA)
   05171 Coronavirus disease - COVID-19
    102887078 (PRKCA)
   05164 Influenza A
    102887078 (PRKCA)
   05163 Human cytomegalovirus infection
    102887078 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102887078 (PRKCA)
   05143 African trypanosomiasis
    102887078 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102887078 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102887078 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102887078 (PRKCA)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     102887078 (PRKCA)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   102887078 (PRKCA)
Membrane trafficking [BR:pale04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    102887078 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like APH
Other DBs
NCBI-GeneID: 102887078
NCBI-ProteinID: XP_015445192
LinkDB
Position
Unknown
AA seq 672 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNAE
LRQKFEKAKLGPAGNKVISPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMEGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgattccacagcgtctcaggacgtggccaaccgcttc
gcgcgcaaaggggcgctgagacagaagaacgtgcatgaggtgaaggaccacaaattcatc
gcccggttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgttacattttcctgtccgggtgcggataagggacccgacactgatgaccccaggagc
aagcacaagtttaaaatccacacttacggaagccccaccttctgtgatcactgtgggtca
ctgctgtacggacttatccatcaagggatgaaatgtgacacctgcgacatgaatgtgcac
aagcagtgtgtgataaacgtccctagcctctgtgggatggaccacacagagaagaggggg
cggatctacctgaaggctgaggtcaccgacgaaaagctccatgtcacagtacgagatgca
aaaaatctcatccctatggatccaaatggactttcagacccttacgtgaagctgaaactt
attcctgatcccaagaatgaaagcaaacaaaaaaccaaaaccatccgctccacactgaac
cctcagtggaatgagtcgtttaccttcaaattaaaaccttcggataaagaccgacgactg
tccgtagaaatctgggactgggatcgaacaacaaggaacgacttcatgggctccctttcc
ttcggcgtttcggagttgatgaagatgccggccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaacgtgcccattccagaaggagatgaggaaggaaacgcggag
ctccggcagaaattcgagaaagccaagcttggccctgctggtaacaaagtaatcagtcct
tcagaagacaggagacaaccttccaacaaccttgacagggtgaaactcaccgacttcaat
ttcctcatggtcctggggaaggggagttttggaaaggtgatgctggccgacaggaagggt
acggaagaactgtacgctatcaaaatcctgaagaaggacgtggtgatccaggacgacgac
gtggaatgcaccatggtagagaagcgcgtgctggctttgcttgacaagccgccgttcctg
acacagctgcactcctgcttccagacggtggatcggctctacttcgtcatggaatacgtc
aacggcggggacctcatgtaccacatccagcaagtaggaaaatttaaggaaccccaagca
gtattctatgcagcagagatttccattggattgttctttcttcataaacgaggaatcatt
tatagggatctgaagctagataacgtcatgctggattcagagggacacatcaagattgcc
gactttgggatgtgcaaggaacacatgatggagggagtcacgaccaggaccttctgtggg
accccagattacatcgccccggagataatcgcttatcagccgtacgggaaatctgtggac
tggtgggcctacggcgtcctgttatatgaaatgctggccgggcagcccccattcgacggt
gaagatgaagacgagttgtttcagtctataatggagcacaacgtttcttatccgaaatct
ctatccaaggaggccgtttccatctgcaaaggactgatgaccaaacatcccggcaagcgt
ctgggctgcgggcccgagggggaacgggacgtgcgagaacacgccttcttccggaggatc
gactgggagaaactggaaaacagggagatccagccgccattcaagcccaaagtgtgcggc
aaaggagcagaaaactttgacaagttcttcacacgagggcagcctgtcttaacgcctccc
gaccagctggtcattgctaacatagaccagtctgatttcgaagggttctcgtacgtcaac
ccccagttcgtgcaccccatcttacagagcgcagtatga

KEGG   Pteropus alecto (black flying fox): 102888961
Entry
102888961         CDS       T02993                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04066  HIF-1 signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04150  mTOR signaling pathway
pale04270  Vascular smooth muscle contraction
pale04310  Wnt signaling pathway
pale04370  VEGF signaling pathway
pale04510  Focal adhesion
pale04540  Gap junction
pale04613  Neutrophil extracellular trap formation
pale04650  Natural killer cell mediated cytotoxicity
pale04666  Fc gamma R-mediated phagocytosis
pale04670  Leukocyte transendothelial migration
pale04713  Circadian entrainment
pale04720  Long-term potentiation
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04727  GABAergic synapse
pale04728  Dopaminergic synapse
pale04730  Long-term depression
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04925  Aldosterone synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04929  GnRH secretion
pale04935  Growth hormone synthesis, secretion and action
pale04960  Aldosterone-regulated sodium reabsorption
pale04961  Endocrine and other factor-regulated calcium reabsorption
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale05017  Spinocerebellar ataxia
pale05022  Pathways of neurodegeneration - multiple diseases
pale05031  Amphetamine addiction
pale05032  Morphine addiction
pale05143  African trypanosomiasis
pale05146  Amoebiasis
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05214  Glioma
pale05223  Non-small cell lung cancer
pale05225  Hepatocellular carcinoma
pale05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102888961 (PRKCG)
   04012 ErbB signaling pathway
    102888961 (PRKCG)
   04014 Ras signaling pathway
    102888961 (PRKCG)
   04015 Rap1 signaling pathway
    102888961 (PRKCG)
   04310 Wnt signaling pathway
    102888961 (PRKCG)
   04370 VEGF signaling pathway
    102888961 (PRKCG)
   04066 HIF-1 signaling pathway
    102888961 (PRKCG)
   04020 Calcium signaling pathway
    102888961 (PRKCG)
   04070 Phosphatidylinositol signaling system
    102888961 (PRKCG)
   04071 Sphingolipid signaling pathway
    102888961 (PRKCG)
   04150 mTOR signaling pathway
    102888961 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102888961 (PRKCG)
   04540 Gap junction
    102888961 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102888961 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    102888961 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    102888961 (PRKCG)
   04670 Leukocyte transendothelial migration
    102888961 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    102888961 (PRKCG)
   04929 GnRH secretion
    102888961 (PRKCG)
   04921 Oxytocin signaling pathway
    102888961 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    102888961 (PRKCG)
   04918 Thyroid hormone synthesis
    102888961 (PRKCG)
   04919 Thyroid hormone signaling pathway
    102888961 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    102888961 (PRKCG)
   04916 Melanogenesis
    102888961 (PRKCG)
   04925 Aldosterone synthesis and secretion
    102888961 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102888961 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    102888961 (PRKCG)
   04971 Gastric acid secretion
    102888961 (PRKCG)
   04972 Pancreatic secretion
    102888961 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102888961 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102888961 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    102888961 (PRKCG)
   04727 GABAergic synapse
    102888961 (PRKCG)
   04725 Cholinergic synapse
    102888961 (PRKCG)
   04728 Dopaminergic synapse
    102888961 (PRKCG)
   04726 Serotonergic synapse
    102888961 (PRKCG)
   04720 Long-term potentiation
    102888961 (PRKCG)
   04730 Long-term depression
    102888961 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    102888961 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102888961 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102888961 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102888961 (PRKCG)
   05206 MicroRNAs in cancer
    102888961 (PRKCG)
   05205 Proteoglycans in cancer
    102888961 (PRKCG)
   05231 Choline metabolism in cancer
    102888961 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102888961 (PRKCG)
   05214 Glioma
    102888961 (PRKCG)
   05223 Non-small cell lung cancer
    102888961 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    102888961 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    102888961 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    102888961 (PRKCG)
   05032 Morphine addiction
    102888961 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102888961 (PRKCG)
   05161 Hepatitis B
    102888961 (PRKCG)
   05171 Coronavirus disease - COVID-19
    102888961 (PRKCG)
   05163 Human cytomegalovirus infection
    102888961 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102888961 (PRKCG)
   05143 African trypanosomiasis
    102888961 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102888961 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102888961 (PRKCG)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     102888961 (PRKCG)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   102888961 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like APH
Other DBs
NCBI-GeneID: 102888961
NCBI-ProteinID: XP_006907216
LinkDB
Position
Unknown
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GLDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPISPTPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcaggcctgggccccggcggcggcgattcagaggggggcccccggcccctattttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagccaaccttctgcagccactgcaccgacttcatctgggggattgga
aaacagggcctgcaatgtcaagtctgcagttttgtggttcatcggcgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgatcccaggaacaag
cacaagttccgcctgcacagctacagtagccccaccttctgcgaccactgcggctccctc
ctttacgggctggtacatcagggcatgaaatgctcttgctgcgagatgaacgtgcatcgg
cgctgcgtgcgcagcgtgccctctctgtgcggcgtggaccacacagagcgtcgcgggcgc
ctgcagctggaaatccgggctccgaccgcagatgagatccacatcacggttggtgaggcc
cggaatctcatcccaatggatcccaatggtctgtctgacccctatgtgaaactgaagctc
atcccagaccctcggaatttgacaaaacagaagacccggaccgtgaaagccacgctgaac
cctgtgtggaacgagacctttgtgttcaacctgaagccaggggatgtggaacgcaggctc
agtgtggaggtgtgggactgggaccggacctcccgcaatgacttcatgggcgccatgtcc
tttggtgtctcagagctgctcaaggcaccggtggacggatggtacaagttactgaaccag
gaggagggcgaatattacaatgtgccggtggctgatgctgacaactgcagcctcctccag
aagtttgaggcctgtaactaccccctggaactgtatgagcgagtgcggatgggtccttcc
tcctctcccatcccctccccatcccctagtcccacagactccaagcgctgtttcttcggg
gcgagtcctggacgtctgcacatctccgacttcagcttcctcatggttctggggaaaggc
agctttgggaaggtgatgctggccgagcgtaggggctccgatgagctctacgccatcaag
atcctgaagaaagacgtgattgtacaggatgatgatgtggactgcaccctggtggagaaa
cgtgtgctggccctgggaggcagaggccctggaggccggccccactttctcacccagctc
cactccaccttccagaccccggatcgcttgtattttgtgatggaatatgtcaccgggggc
gacttgatgtaccacattcagcagctgggcaaatttaaggagccccatgcagcgttctat
gcagcggaaatcgccattggcctcttcttccttcacaatcagggcatcatctaccgggac
ctgaaactggacaacgtgatgctggacgccgaaggacacatcaaaatcactgacttcggc
atgtgtaaggagaacgttttccctgggaccacgacccgcactttctgcgggaccccggac
tacatagcccccgagattattgcctaccagccctatgggaaatctgtcgactggtggtcc
tttggggtgctgctgtatgagatgttggcgggacagcccccctttgatggggaagatgaa
gaggagctgtttcaggctatcatggaacaaactgtcacctaccccaagtctctctcccgg
gaagctgtggccatctgcaaggggtttctaaccaaacaccctgctaagcgcctgggttca
gggcttgatggggagcccaccatccgtgcccatggctttttccgctggatcgactgggaa
cggctggaacggttggagatcccacctccgtttagaccccgcccgtgtggccgcagcggc
gagaacttcgacaagttcttcacgcgggcagcgccagcgctgacacccccggaccgccta
gttctggccagcatcgaccaggcagatttccaaggcttcacctacgtgaatccggatttc
gtgcacccggatgcccgcagccccatcagcccaacgcccgtgccagtcatgtaa

DBGET integrated database retrieval system