KEGG   Pteropus alecto (black flying fox): 102880857
Entry
102880857         CDS       T02993                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1 isoform X1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04218  Cellular senescence
pale04310  Wnt signaling pathway
pale04380  Osteoclast differentiation
pale04625  C-type lectin receptor signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04921  Oxytocin signaling pathway
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05135  Yersinia infection
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102880857 (NFATC1)
   04310 Wnt signaling pathway
    102880857 (NFATC1)
   04024 cAMP signaling pathway
    102880857 (NFATC1)
   04022 cGMP-PKG signaling pathway
    102880857 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102880857 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102880857 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    102880857 (NFATC1)
   04660 T cell receptor signaling pathway
    102880857 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    102880857 (NFATC1)
   04659 Th17 cell differentiation
    102880857 (NFATC1)
   04662 B cell receptor signaling pathway
    102880857 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102880857 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102880857 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102880857 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102880857 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102880857 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102880857 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102880857 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    102880857 (NFATC1)
   05161 Hepatitis B
    102880857 (NFATC1)
   05163 Human cytomegalovirus infection
    102880857 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102880857 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102880857 (NFATC1)
Transcription factors [BR:pale03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    102880857 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 102880857
NCBI-ProteinID: XP_006913802
LinkDB
Position
Unknown
AA seq 924 aa
MTGLEEDQEFDFDFLFEFNQSDEGAAAAAPEHCGYAPSNLGPGLPLATAHPSLPAPCHDL
QTAAPDISAVVAASHPSAYGAVVDSGPSGYFLPSSHVRPNGAPALESPRIEITSYLGLHP
GSGQLFHDVEVEDVLPSSKRPPSTATLNLPNLEAYRDPSCLSPASSLSSRSCNSEASSYE
SNYSYPYASPQTSPWQSPCVSPKTTDPEDGFPRGLGACSLLGSPRHSPSTSPRTSVTEES
WLGPRGSRPSSPCNKRKYGLNGRQLSCSPHHSPTPSPHSSPRVSVTDDTWLGNTTQYTSS
AIVAAINALSTDGSLDLGDGVPIKARKTALDHSPSVALKVEPAGEDLGTTPPASDVPPEE
FAAFQHVRKGAFCDQYLAVPQHPYQWARPRSPAPYASPTLPALDWQLPSHSGPYELRIEV
QPKSHHRAHYETEGSRGAVKASAGGHPSVQLHGYVENEPLTLQLFIGTADDRLLRPHAFY
QVHRITGKTVSTTSHEAILSNTKVLEIPLLPENNMRAIIDCAGVLKLRNSDIELRKGETD
IGRKNTRVRLVFRVHIPQPDGRTLSLQVASNPIECSQRSAQELPLVEKQSTASCPVVGGR
RMVLSGHNFLQDSKVIFVEKAPDGHHIWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPV
QVNFYVCNGKRKRSQYQHFTYLPANVPIIKTEPTDDYEPALTCGPASQGLSPLPKPCYSQ
QLAMPPGPGACLVAGFPPCPQRSTMMSPPPSASPKLHDLSSAPYSKGMANPGHDPLRLQR
PAGGALLGQEAPRPMGVHPGSPQQPQVSPQLSSSCSPGHQPALCANSPSSPLLPGAQEPT
CLQSCSPARPSGMGHLQHQLPKVLEKASAATRPLPLPEVREDSNHSLAPTPVSVKREPQD
LDQLYLDDVNEIIRNDLSSTNVHS
NT seq 2775 nt   +upstreamnt  +downstreamnt
atgacggggctggaggaggaccaggagttcgactttgatttcctctttgagtttaaccaa
agcgacgagggcgccgccgcggctgccccagagcactgcggttatgcaccctccaacctc
ggccccggcctgcccctggccacggcgcacccctcgctgccggctccgtgccacgacctg
cagacggcggcccccgacatctcggccgtggtggcggcgagccacccctcggcgtacggg
gccgtggtggacagcgggccctcgggctacttcctgccgtccagccacgtgaggcccaac
ggtgccccggccctggagagtccgcgcatcgagattacgtcgtacctagggctgcacccc
ggcagcggccagctgttccacgacgtggaggtggaggacgtcctgcccagctccaagcgg
cccccgtccacggccaccttgaacctgcccaacttggaggcctaccgcgacccgtcctgc
ctgagcccggccagcagcctgtcgtcccgcagctgcaactccgaggcctcgtcctacgag
tccaactactcgtacccgtacgcctccccgcagacgtccccctggcagtcgccctgcgtg
tcccccaagaccacggaccccgaggacggctttccccgcggcctgggcgcctgcagcctg
ctcggctccccgagacactcgccctccacctcgccccgcacgagcgtcaccgaggagagc
tggctggggccacgcggctcccggccctcgtccccctgcaacaagaggaagtacggcctc
aacggccggcagctgtcctgctccccacaccactcgcccaccccgtccccgcacagctcg
ccgcgggtcagcgtcaccgacgacacatggctgggcaacaccacgcagtacaccagctcg
gccatcgtggccgccatcaacgccctgagcaccgacggcagcctggacttgggtgacggg
gtccccatcaaggcccgcaagaccgccctggaccactcgccctcggtggcgctcaaggtg
gagccagccggagaggacctggggaccacgccgcccgcgtccgacgtcccgcccgaggag
ttcgctgccttccagcacgtgcggaagggcgccttctgcgaccagtacctggcggtgccg
cagcacccgtaccagtgggcccggcccaggtcgcccgcaccctatgccagcccgaccctg
cccgctctggactggcagctgccgtcgcactcgggaccctacgagctgaggatcgaggtg
cagccgaagtcgcaccaccgagcccactacgagacggagggcagccggggggccgtgaag
gcgtcagccggaggacaccccagcgtgcagctccacggctacgtggagaacgagccgctg
acgctgcagctgttcatcgggacggcggacgaccgcctgctgaggccacacgccttctac
caggtgcaccgcatcacggggaagaccgtgtccaccaccagccacgaggccatcctctcc
aacaccaaggtcctggaaatcccgcttctgccggaaaacaacatgcgtgccatcatcgac
tgtgccggggtcctcaagctgcggaactccgacatcgagctgcgcaagggcgagaccgac
atcggccggaaaaacacccgcgtgcggctcgtcttccgcgtccacatcccgcagcctgac
ggccgcacgctgtcgctgcaggtcgcctcgaaccccatcgagtgctcccagcggtcggca
caggagctgcccctcgtggagaagcagagcacagccagctgccctgttgtcggcgggagg
aggatggtcctgtccggccacaacttcctgcaggactccaaggtcattttcgtggagaag
gcgccagatggccaccacatctgggaaatggaggcgaagaccgaccgagacctgtgcaag
ccgaattcactcgtggtcgagataccgccattccgcaatcagaggataaccagccccgtc
caagtcaatttctacgtctgcaatgggaagaggaagagaagccagtaccagcacttcacc
taccttcctgccaacgttccaatcatcaagacagaacccacagatgactacgagccggcc
ctgacctgtggaccagcaagccagggcctaagcccactcccgaagccgtgctacagccag
cagctcgccatgccgcccggcccgggagcctgcctcgtggccggcttcccgccctgtcca
cagaggagcaccatgatgtcgccgccgcccagcgccagcccgaagctccacgacctctct
tctgccccctacagcaagggcatggccaacccgggccacgaccccctcagacttcagcgg
ccagccggaggggccctcttggggcaggaggcgccgagacccatgggcgtgcacccaggc
tccccccagcagccacaggtgagtccacagctgagcagcagctgttccccgggtcaccag
ccagcgctctgtgccaacagcccctcctctccactgctgcccggtgcccaagagccgacc
tgtttgcagtcctgcagcccagcccgcccatccgggatgggccacctgcagcaccagctg
ccgaaggttctggaaaaagcgtctgcagccacccggcctctgccgctgcccgaggtgcgt
gaggacagtaatcatagtctggcccccactcccgtatcggtcaagcgagagcctcaagac
ttggaccagctgtacctggacgacgtaaatgaaataatacgaaacgacctctccagcacc
aacgtccactcgtag

KEGG   Pteropus alecto (black flying fox): 102884312
Entry
102884312         CDS       T02993                                 

Gene name
NFATC3
Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear factor of activated T-cells, cytoplasmic 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04218  Cellular senescence
pale04310  Wnt signaling pathway
pale04360  Axon guidance
pale04625  C-type lectin receptor signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04921  Oxytocin signaling pathway
pale05135  Yersinia infection
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102884312 (NFATC3)
   04310 Wnt signaling pathway
    102884312 (NFATC3)
   04022 cGMP-PKG signaling pathway
    102884312 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102884312 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102884312 (NFATC3)
   04660 T cell receptor signaling pathway
    102884312 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    102884312 (NFATC3)
   04659 Th17 cell differentiation
    102884312 (NFATC3)
   04662 B cell receptor signaling pathway
    102884312 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102884312 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    102884312 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102884312 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102884312 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102884312 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    102884312 (NFATC3)
   05161 Hepatitis B
    102884312 (NFATC3)
   05163 Human cytomegalovirus infection
    102884312 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102884312 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102884312 (NFATC3)
Transcription factors [BR:pale03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    102884312 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 102884312
NCBI-ProteinID: XP_024901067
LinkDB
Position
Unknown
AA seq 1075 aa
MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDRASIYIFNVDPPPSTLNSPL
CLPHHGLPSHSSVLSPSXXXXXXXXXXXXXXXXXESKYGPLGGPKPFECPSIQITSISPN
CHQEIDAHEDDLHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDA
SSCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGLGHSLSPRQ
SPCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGH
SPRGSVTEDTWLNASVQGGSGLGPALFPFQYYVETDIPLKTRKTSEDQATVLPGKLELCS
DDQGSLSPSRETSIDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPP
LDWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPINLQ
MFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAG
ILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQTASIPVECSQRSAQEL
PHIEKYSINSCSVNGGHEMVVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAH
IVLEVPPYHNLAVTTAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREDIDLSSVPSLP
VPHPAQTQRPSSDTGHPCDSVLSVQRSLVCPIQQTYTSLVTSSHLPQLQCRDESSGKEQH
MIPSSVMHQPFQVTSTPPVGSSYQPMQTNVYNGPTCLPINAASSQEFDPVLFQQAAVLPN
LINLGCQPPSSIPFHSSNSGSTGHLLAHTPHSVPTLPHLQSMGYHCPNTGQRSLSSPVAD
QVTGQTSPQLQSITYVPSLSGSAATVSPAVSYPLASSPLSGPPSPQLQPMPYQSPSSGTA
SSPTLATRMHSGQHSAQAQSTGQGSLSAPSTLMCHSLCDPASFPSDEAIINIKPEPEEQE
PNFSTIGLQDITLDDVNEIIGRDMSQISVSQGTGVSRQSPLPGPDSLDLGRSEGL
NT seq 3228 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtctttggcgag
gacggggcgccggcgccgccgcccccgggctcgcggcctgcagatcttgagccagatgat
cgtgcgtctatttacatctttaatgtagatccacctccatctactttaaactcaccactt
tgcttaccacatcatggattaccgtctcactcttctgttttgtcaccatcnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncagaatctaaatatggccct
ttaggtggtcccaaaccctttgagtgtccaagtattcaaattacatccatctctcctaac
tgtcatcaagaaatagatgctcatgaagatgacctacacataaatgacccagaaagggaa
tatttggaaagaccttctagagatcatctctatcttcctcttgagccatcttaccgggag
tcttcccttagtcctagtcctgccagcagcatctcttctaggagctggttctcagatgca
tcttcttgtgaatctctttcacatatttatgatgatgtagattcagagttgaatgaagct
gctgcacgatttactcttggatcccctctgacttctcctggtggctctccagggggctgc
cctggagaagagtcctggcatcaacagtatggacttggacactccttgtcacccaggcag
tctccttgtcactctcctagatctagtgtcactgatgagaattggctgagccccaggcca
gcctcaggaccctcatcaaggcctacttccccctgtgggaaacggcggcactctagtgct
gaggtttgttatgctgggtccctttcaccccatcactcacctgttccttctcctggtcac
tcccccaggggaagtgtaacagaagatacctggcttaatgcttctgtccagggtggatca
ggccttggccctgcactttttccatttcagtactatgtagagactgatatccctctgaaa
acaaggaagacttctgaagatcaagctactgtactaccaggaaaattagagctctgttca
gatgatcaagggagtttatcgccatcccgggagacttcaatagatgatggccttggatct
cagtatcctttaaagaaagattcatctggtgaccaatttctttcagttccttcacccttt
acctggagcaaacccaagcctggccacacccctatatttcgcacatcttcattacctcca
ctagactggcctttaccaactcattttggacaatgtgaactgaaaatagaagtgcaacct
aaaactcatcatcgagcccattatgaaactgagggtagccgaggagcagtaaaagcatct
actggggggcaccctgttgtgaagctcctgggctatagtgaaaagccgataaatctacag
atgtttattggaacagcagatgatcgatatttacgacctcatgcattttaccaggtgcat
cgaatcactgggaaaacagttgctactgcaagccaagagataataattgccagcacaaag
gttctggaaattccacttctccctgaaaataatatgtcagccagtattgactgtgcaggt
attttgaaacttcgcaattcagatatagaacttcgaaaaggagaaactgatattggcaga
aagaatactagagtacgacttgtgtttcgtgtacacattccacagcccagtggaaaagtc
ctttctctgcagacagcttcaatacctgttgagtgctcccagaggtctgctcaagaactt
cctcatattgagaagtacagtatcaacagttgttctgtaaatggaggtcatgaaatggtt
gtgactggatctaattttcttccagaatcaaaaatcatttttcttgaaaaaggacaagat
ggacgacctcagtgggaggtagaagggaaaataatcagggaaaaatgtcaaggggctcac
attgtccttgaagttcctccatatcataacctagcagttacaactgcagtgcaggtgcac
ttttatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacacca
gttttgatgaagcaagaacacagggaagatattgacttgtcttcagttccatcattgccc
gtgcctcatcctgcccagacccagagaccttcctcagatacaggacacccatgtgacagt
gtactgtcagtacagagaagcttggtttgtcccatccagcaaacatacacatccttggta
acctcatcccatctgccacagttgcagtgtagggatgaaagttctggtaaagaacagcat
atgataccttcttcagtcatgcaccagccttttcaagtcacatcaacacctcctgtgggg
tcttcctatcagcctatgcaaactaatgtgtacaatggaccaacttgtcttcctattaat
gctgcctctagtcaagaatttgatccagttttgtttcagcaggctgccgttcttcctaat
ttaataaatcttggctgccaaccgccatcatccataccttttcattcttcaaattcaggc
tcaacaggacatctcttagcccacacacctcattctgtgccgaccctgcctcatctacag
tcaatgggataccattgcccaaatactggacaaagatctctttcttctccagtggctgac
caggtcacaggtcagacttcccctcagttacagtccattacatatgttccttcactatca
gggtctgctgcaacagtttccccagcagtttcttatcccttggccagttcaccactttct
ggaccaccatctcctcagctacagcctatgccttaccaatctcctagctcaggaactgcc
tcatcaccaactctagccaccagaatgcattctggacagcattcagctcaagcacaaagt
acaggccagggaagtctttctgcaccttcaaccttaatgtgtcacagtttgtgtgatcca
gcttcatttccatccgatgaggcaattataaacattaaacctgaacctgaagagcaggaa
cctaacttttcaacaattggtctacaggacatcactttagatgatgtgaacgagataatt
gggagagacatgtcccagatttctgtttcccaaggaacaggggtgagcaggcagtctccc
ctccctggtcctgattccctggatttaggaagatccgaagggctctga

KEGG   Pteropus alecto (black flying fox): 102886274
Entry
102886274         CDS       T02993                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04022  cGMP-PKG signaling pathway
pale04218  Cellular senescence
pale04310  Wnt signaling pathway
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04380  Osteoclast differentiation
pale04625  C-type lectin receptor signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04921  Oxytocin signaling pathway
pale05135  Yersinia infection
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102886274 (NFATC2)
   04370 VEGF signaling pathway
    102886274 (NFATC2)
   04022 cGMP-PKG signaling pathway
    102886274 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102886274 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102886274 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    102886274 (NFATC2)
   04660 T cell receptor signaling pathway
    102886274 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    102886274 (NFATC2)
   04659 Th17 cell differentiation
    102886274 (NFATC2)
   04662 B cell receptor signaling pathway
    102886274 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102886274 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    102886274 (NFATC2)
   04380 Osteoclast differentiation
    102886274 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102886274 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102886274 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102886274 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    102886274 (NFATC2)
   05161 Hepatitis B
    102886274 (NFATC2)
   05163 Human cytomegalovirus infection
    102886274 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102886274 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102886274 (NFATC2)
Transcription factors [BR:pale03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    102886274 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 102886274
NCBI-ProteinID: XP_015452675
LinkDB
Position
Unknown
AA seq 918 aa
MDAPEQQPDPDGYEPGGSPQDELDFSILFNYDYLNPIEEEPNAHKVASPPSGLAYSDDVL
DYGLKPYSPLPSLSGEPPGRFGEPDRVGPQNFLSPAKPAGASGLSPRIEITPSHELMQAG
GPLRVRDTGLLGEQAPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSP
YTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRS
SSPGAKRRHSCAGALVAPLPGASPQRSRSPSPQPRDDGAPAGYPPTAGSAVLMDALNSLA
ADSPCGIPTKMWKTSPDPSPVPAAPSKAGLPRHLYPAVEFLGPCEQEERRNSAPESILLV
PPTQASWVKQLVPAIPICSIPVTASLPPLEWPLSHQSGSYELRIEVQPKPHHRAHYETEG
SRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTS
YEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRV
HIPEPSGRIVSLQTASNPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQNFTAESK
VVFTEKTTDGQQIWEMEATVDKDKSQSNMLFVEIPEYRNKHIRTSVKVNFYVINGKRKRS
QPQHFTYHPAVPAIKTEPSDEYDPTLICSSAHGGLGSQPYYPQHPIVAESPSCLVATMAP
CQQFRSGLSSPDARYQQQNPAAVLYQRSKSLSPTLLGYQQPALMAAPLSLTDAHCSVLMH
TGSQGQSSALLHSSPANQQASPVIHYSPTNQQLRCGSHQEIQHIMYCENFPPGTTRPGPP
PVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPTGVTIKQEQNLDQTYLDD
VNEIIRKEFSGPPARNQT
NT seq 2757 nt   +upstreamnt  +downstreamnt
atggatgccccggagcagcagcccgaccctgacggctacgagccggggggcagcccccag
gacgagttggacttctccatcctcttcaactatgactatttgaatcctatcgaagaagaa
ccgaatgcacataaggtcgccagcccaccctccggacttgcgtactctgatgatgtcctg
gactatggcctcaagccatacagccccctccccagtctctctggcgagccccccggccga
ttcggagagccggatagggtagggccccagaactttctgagcccggccaagccagcgggg
gcctcgggcctgagccctcggatcgagatcactccatcccacgaactgatgcaggcaggg
gggcccctccgcgtgagagacactggcctcctgggggagcaggcgcccctggcgggcgtg
gccgccagcccgaggttcaccctgcccgtgcctggcttcgagggctaccgcgagccgctt
tgcttgagccccgctagcagcggctcctctgccagcttcatttccgacaccttctccccc
tacacctcgccctgcgtctcgcccaataacggcgggcccgacgacctgtgtccccagttt
caaaacatccctgctcattattcccccagaacctcgccaataatgtcacctcgaaccagc
ctcgctgaggacagctgcctgggccgccactcgcccgtgccccgtccggcctcccgctcc
tcgtcgcctggtgccaagcggaggcattcgtgcgccggggccttggttgccccgctgccc
ggagcctcaccccagcgctcccgcagcccctcgccgcagccgcgggacgacggcgccccc
gctgggtacccccccacggccggctctgccgtcctcatggatgctctgaacagccttgcc
gcggactcgccttgtgggattcccaccaagatgtggaagaccagccccgacccgtcgccc
gtgcctgccgcgccgtccaaggccggcctgccccgccacctctacccggccgtggagttc
ctggggccctgcgaacaggaggagaggaggaactcggcccccgagtccatcttgctggtg
ccgccgactcaggccagctgggtcaagcagctggtgcccgctattcccatctgcagtatc
ccagtgactgcatccctccctccactcgagtggccactgtcccaccagtcaggctcctat
gagctgcggattgaggtgcagcccaagccacaccaccgggcccactatgagacagaaggc
agccgaggggctgtcaaagccccaaccggtggccaccctgtggttcagcttcacggctac
atggaaaacaagccgctcggacttcagatcttcatcgggacggccgacgagcggatcctg
aaaccccacgccttctaccaggtgcaccggatcacggggaaaactgtcaccaccaccagc
tacgagaagatcgtgggcaacaccaaagtcctggagataccgctggagccgaaaaacaat
atgagggcgaccatcgactgtgcggggatcctgaagctcagaaatgctgacatcgagctg
cggaaaggagagaccgacatcggcaggaagaacacacgggtgaggctggttttccgggtg
cacattccggagcccagcggaaggatcgtctccttgcagactgcgtcgaaccccattgag
tgctcccagcggtctgcccacgagctgcccatggtggaaagacaggacatcgacagctgc
ctggtctacgggggccagcagatgatcctcacgggacagaacttcacggccgagtcgaaa
gtcgtgttcacggagaagaccacagatgggcagcaaatttgggagatggaggccacggtg
gataaagacaagagccagtctaacatgctttttgttgagatccccgagtatcggaacaag
cacatccgcacgtcggtgaaagtgaacttctacgtcatcaacgggaagagaaaacggagt
cagcctcagcactttacctaccacccagcagtcccagccatcaagacggagcccagcgat
gaatatgaccccaccttgatctgtagctccgcccacgggggcctggggagccagccttac
tacccgcagcacccaatagtggccgagtccccctcctgcctcgtggccaccatggctccc
tgccagcaattccgctcggggctctcgtcccccgacgcccgctaccagcagcagaacccg
gcggctgtcctgtaccagcgcagcaagagcctgagccccaccctgctgggctaccagcag
ccggccctcatggccgccccgctgtccctcacggatgcgcactgctccgtgctgatgcat
accggctcccagggccagagctcggctctgctccactcttccccggccaaccagcaggcc
tcgccggtgatccactactcgcctaccaaccagcagctgcgctgcgggagtcaccaggag
attcagcacatcatgtactgcgagaatttcccacccggcaccaccaggcccggcccgccc
cctgtcagtcaaggtcagaggctgagcccggggtcctaccccacggtcattcagcagcag
aatgccacaagccaaagagccgccaaaaatggacccccggtcagtgaccaaaaggaagta
ttacccacaggagtgacaatcaaacaggagcagaacttggatcagacctatctggatgac
gttaatgaaattatcaggaaggagttttcaggacctcccgccagaaatcagacgtag

KEGG   Pteropus alecto (black flying fox): 102888827
Entry
102888827         CDS       T02993                                 

Gene name
NFATC4
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04022  cGMP-PKG signaling pathway
pale04218  Cellular senescence
pale04310  Wnt signaling pathway
pale04360  Axon guidance
pale04625  C-type lectin receptor signaling pathway
pale04921  Oxytocin signaling pathway
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102888827 (NFATC4)
   04022 cGMP-PKG signaling pathway
    102888827 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102888827 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102888827 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102888827 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    102888827 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102888827 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    102888827 (NFATC4)
   05161 Hepatitis B
    102888827 (NFATC4)
   05163 Human cytomegalovirus infection
    102888827 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102888827 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102888827 (NFATC4)
Transcription factors [BR:pale03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    102888827 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 102888827
NCBI-ProteinID: XP_024903796
LinkDB
Position
Unknown
AA seq 901 aa
MGAASCEDEELEFKLVFGEEKEAPPLSTGGPGEELDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGSSGGTGGGRVLECPSIRITS
ISPTPDPPATLEDNPDAWGDGSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWS
FFSDTSDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPDDPWSLYGPSPAG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEAPPP
PPLPLVRDPGSPGPFDYVGAPPVESIPQKTRRTSSEQAVALPRSEEPASCNGKLPSGAEE
AAAPPGGPRKEVAGMDYLAVPSPLAWSKARIGGHSPVFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYNEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGNGKVVSVQTASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFKFLPVIFKEEPLPDPSLRGFPSASGPSFGNDMDFSPPRP
PYPSYPHEDPAYETPYLSEGFSYGTPPLYPQTGPPPSYRPGLRMFPETGGTTGCARPPPV
SFLPRPFPNDPYGGRGSPFPLGLPFPPPAHFRPPLPSSPTLEGPFPPQSGAHPTPAEGYN
EVGPSYGPGEGAPEQEKSRGGYGSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEPP
A
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgggggcagcaagctgcgaggatgaggagctggaatttaagctggtgttcggggaggaa
aaggaagcccctccgttgagcacgggggggccgggggaagaactggactcagaggatgcc
ccaccatgctgccgtctggccctgggagagccccctccctatggcgctgcccctattggc
attcctcggccaccaccccctcggcccggcatgcactcaccaccaccccgcccagccccc
tcacctggcacttgggagagccagccagcccgatcagtgaggctgggggggccaggaggg
agctctggggggactgggggaggccgtgtccttgaatgcccaagcatccgtatcacttcc
atctctcccacgcctgacccgccagccacgctggaggacaaccctgatgcgtggggggat
ggctcccccagggattaccccccgccagaaggctttggaggctaccgagaggcagggggc
cagggagggggcgccttcttcagcccgagccctggcagcagcagcctgtcctcgtggagc
ttcttctcggatacctctgatgaggcagccctgtatgcggcatgcgatgaggtggagtct
gagctaaatgaagcagcctcccgctttggcctgggctccccgctgccctcgccccgggcc
tcccctaggccatggacccccgatgatccctggagcctgtatggtccgagccccgcaggc
cgagggccggaagatagctggctactcctcagcgctcctgggcccaccccggcctctcca
cggcctgcctctccatgtggcaaacggcgctattccagctccggaaccccatcttcggcc
tctccggctctgtcccgcaggggcagcctgggggaggaggggcctgaggcacctccacca
cccccattgcctctggtccgggaccctggctctcctggcccctttgactatgtgggagcc
ccacctgtggagagcatcccccagaaaacccggcggacttccagcgagcaggcggtggcc
ctgcctcggtctgaggagcctgcctcatgcaatgggaagctgccttctggagccgaggag
gctgcagctcctccagggggtcctcggaaggaggtggccggcatggactacctggcagtg
ccttcccctttggcttggtccaaggcccggattgggggacacagccccgtcttcaggacc
tctgccctacccccgctggactggcctctgcccagccagtatgagcagctggaactgagg
attgaggtgcaacctagagcccaccaccgggcccactatgaaacagagggcagccgaggt
gctgtcaaagctgcccctggtggtcatcccgtagtcaagctcctaggctataatgagaag
ccactgaccctacagatgttcattggcactgctgatgaaaggaacctgcggcctcatgcc
ttctatcaggtgcaccggatcactggcaagatggtagccacagccagctatgaagctgta
gtcagtggtacgaaggtgttagagatgaccttgcttcccgagaacaacatggcagctaac
attgactgtgctggaatcctgaagcttcggaattcagacattgagctgcggaagggtgag
acggacatcggacgcaagaacacacgtgtgcggctggtgttccgggtacatgtgccccag
ggcaatgggaaggtcgtctctgtgcagactgcatcagtgcccatcgagtgctcccagcgc
tcggcacaggagctgccccaggtggaggcttatagccccagtgcctgctctgtgagagga
ggagaggaactagtgctgactggctccaacttcctgccagactccaaggtggtgttcatt
gagagaggccctgatggaaagctgcaatgggaggaggaggccacagtgaaccggttgcag
agcaatgaggtgacactgactctgactgtccctgagtacagcaacaagcgggtgtcccgg
cccgtccaggtctacttttatgtctccaatgggcgcaggaagcgcagccctacccagagt
ttcaagttcctgcctgtgatcttcaaggaggagccactaccagacccatctctccggggc
ttcccttcagcatcgggcccctcctttggcaatgacatggacttctcaccacccagaccc
ccctatccctcctatcctcatgaagaccctgcttatgaaactccttacctgtcagaaggc
ttcagctatggcacaccccctctgtacccccagacagggcctccaccatcctacagacct
ggccttcggatgttccctgagactgggggtactacgggttgtgcccgcccacctccagtc
tctttccttccccggcccttccctaatgacccgtatgggggaaggggctccccttttccc
ctggggctgccattccctcctccagcccatttccggcctccactgccttcttccccaacg
ttggaaggccccttccctccccagagtggtgctcatcccacacctgctgagggatacaat
gaggtagggccaagctatggccctggggagggggctccggagcaggagaaatccaggggt
ggctacggcagcggcttccgagacagtgtccctatccagggtatcacgctggaggaagtg
agtgagatcattggccgagacctgagtggcttccctgcacctcccggagaagagcctcct
gcctga

DBGET integrated database retrieval system