KEGG   Pteropus alecto (black flying fox): 102881042
Entry
102881042         CDS       T02993                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04024  cAMP signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04310  Wnt signaling pathway
pale04330  Notch signaling pathway
pale04350  TGF-beta signaling pathway
pale04520  Adherens junction
pale04630  JAK-STAT signaling pathway
pale04720  Long-term potentiation
pale04916  Melanogenesis
pale04919  Thyroid hormone signaling pathway
pale04922  Glucagon signaling pathway
pale04935  Growth hormone synthesis, secretion and action
pale05016  Huntington disease
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05206  MicroRNAs in cancer
pale05211  Renal cell carcinoma
pale05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102881042 (EP300)
   04330 Notch signaling pathway
    102881042 (EP300)
   04350 TGF-beta signaling pathway
    102881042 (EP300)
   04630 JAK-STAT signaling pathway
    102881042 (EP300)
   04066 HIF-1 signaling pathway
    102881042 (EP300)
   04068 FoxO signaling pathway
    102881042 (EP300)
   04024 cAMP signaling pathway
    102881042 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102881042 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102881042 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102881042 (EP300)
   04935 Growth hormone synthesis, secretion and action
    102881042 (EP300)
   04919 Thyroid hormone signaling pathway
    102881042 (EP300)
   04916 Melanogenesis
    102881042 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    102881042 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102881042 (EP300)
   05206 MicroRNAs in cancer
    102881042 (EP300)
   05203 Viral carcinogenesis
    102881042 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102881042 (EP300)
   05215 Prostate cancer
    102881042 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102881042 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102881042 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102881042 (EP300)
   05161 Hepatitis B
    102881042 (EP300)
   05164 Influenza A
    102881042 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102881042 (EP300)
   05165 Human papillomavirus infection
    102881042 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102881042 (EP300)
   03036 Chromosome and associated proteins [BR:pale03036]
    102881042 (EP300)
   03029 Mitochondrial biogenesis [BR:pale03029]
    102881042 (EP300)
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102881042 (EP300)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    102881042 (EP300)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102881042 (EP300)
Mitochondrial biogenesis [BR:pale03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102881042 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 102881042
NCBI-ProteinID: XP_024906349
LinkDB
Position
Unknown
AA seq 2413 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQNSPGLGLINS
MVKSPIPNMGMGTSGPNQGPTPAATGMMNSPVNQPAMGMNTGMNAGMNPGMLTAGNGQGM
MPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGPQPLKMGM
MNNPNPYGSPYTQNSGQQIGASGLGLQIQSKTVLPNSLSPFAMDKKAVPGGGMPSMGQQQ
APQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNL
PHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQ
QSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQMQTQPPV
QAKNQQNQQSGQSPQGMRPMGNMNASPMGVNGGVGVQTSNLLSDSMLHSAINSQNPMMSE
NASVTSLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRME
NLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVP
VSMNPGPNMGQPQPGMTSNGPLPDPSMIRGNVPNQMMPRAPPQSGLNQFGQIGMPQPPIG
PRQPSSLQHHGQLAQPGTLNPPMGYGPRIQQPSNPNQFLPQTPFPAQGMNVTNMPLAPSG
GQAPVSQAQMSSVSCPVNSPIMPPGSQGSHIHCPPLPQALHQNSPSPVPSRTPTPHHTPP
SIGAQQPPATVIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPPTQLPPQAQPSLPAAASA
DQPQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQTI
PEKQPSQEVKMEAKMEVDQPEPATTQPEDIPEMKTEDCKVEPIETEERGTELKTETKEEE
DLPSTSVTQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIP
DYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSE
VFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNE
IQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEVIWP
SGFICDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNEFLRRQNHPESGEVTVRVVH
ASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPP
PNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYI
FHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGD
FWPNVLEEXXXXXXXXXXXXXREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGN
KKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIIDPDPLIPCDLMDGR
DAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCE
DYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAAATQSPGDSRRLSIQRCIQSLVHACQ
CRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL
NIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTSQQPTTPQ
TPQPPPPPQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAA
VEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMAPMAPIGMNPPPMARGPGGHLEPGMG
PTGMQQQPPWAQGGLPQPQQLQTGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPGT
VSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQSLPGQPG
MPQGQPGLQPPAMPGQQGVHSNPAMQNMNAMQAGVQRAGLPQQQPQQQLQPPVGGMSPQA
QQVNMNHNAMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQ
QQQQRMQHHMQQMQQGNMGPMGQLPQALGPEAGASLQVYQQRLLQQQMGSPAQPNPMSPQ
QHMLPNQAQSPHLQGQQIPSSLSNQVRSPQPVHSPRPQSQPPHSSPSPRMQPQPSPHHVS
PQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLTSNPGMANLHGASATDLGLSTDNSD
LNSTLSQSTLDIH
NT seq 7242 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctttcggcgtcggccagcgatggcacagattttggctctctgtttgacttggag
cacgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacaa
ctgtcagaattgctacggtctggtagttcccccaacctcaatatgggggttggtggccca
ggccaaggcatggccagccaggcccaacaaaacagtcctggattaggtttaataaatagt
atggtcaaaagcccaatccccaacatgggcatgggcacgagtggaccaaatcagggtccc
acgccggctgcaacaggtatgatgaatagtccagtaaatcaacctgccatgggcatgaac
acagggatgaatgctggcatgaatcctggaatgttgactgcaggcaatggacaggggatg
atgcctaatcaagttatgaacggttcaattggagcaggccgggggcgacctaacatgcag
tacccaaacccaggcatgggaaatgctggcaacttaatgactgagccactgcagcagggc
tctccccagatgggaggacaaacaggattgagaggcccccagcctcttaagatgggaatg
atgaacaaccctaatccgtacggttcaccatacactcagaattctggacagcagattgga
gccagtgggcttggtctccagattcagtcgaagactgtactaccaaatagtttatctcca
tttgcaatggacaaaaaggcggttcctggtggaggaatgcccagcatgggccaacagcag
gcccctcaggtccagcagccaggccttgtgactccggtagcccaagggatgggttctgga
gcacacacggctgatccagagaagcgcaaactcatccagcagcagctcgttctccttttg
catgcccacaagtgccagcgccgggagcaggctaatggggaagtgaggcaatgcaacctt
ccccactgtcgcacaatgaagaacgtcttaaaccacatgacacactgccagtcgggcaaa
tcctgccaagtggcacactgtgcatcttctcgacaaatcatttcacactggaagaactgt
acaagacatgattgtcctgtgtgtctcccccttaaaaatgctggggataagagaaatcaa
cagtccattttaactggagcaccagttggacttggaaatactagctctctaggggtgggt
caacagtctacccccagcctaagcactgttagtcagattgatcccagctctatagaaaga
gcctatgcagctcttggactaccctatcaagtaaatcagatgcagacacagcccccagta
caagcaaaaaaccagcagaatcagcagtccggacagtctccccaaggcatgcggcctatg
ggcaacatgaatgctagtcctatgggagtaaatggaggtgtaggggttcaaacatccaat
cttctttccgactcaatgttacattcagccataaattctcaaaacccaatgatgagtgaa
aatgccagtgtgacctccctgggtcctatgccaacagcagctcaaccatccagcactgga
attcggaaacaatggcatgaagatattactcaggatcttcgaaatcatcttgttcacaaa
ctcgttcaagccatatttcctactccggatcctgctgctttaaaagacagacggatggaa
aacctagttgcatatgcccggaaagtggaaggggacatgtatgaatctgcaaataatcga
gctgaatattaccacctgctagccgagaagatctataaaatccagaaagaactagaagaa
aaacgaaggactagactacaaaaacaaaacatgctaccaaatgctgcaggcatggttcca
gtttccatgaatccagggcctaacatggggcagccacaaccaggaatgacttctaatggc
cctcttcctgatccatctatgatccgtggcaatgtgccaaaccagatgatgcctcgggca
ccgccacaatctggtttgaatcaatttggccagataggtatgccccagccccctattgga
ccacggcaaccctcttctcttcagcaccatggacagttggctcagcctggaactctcaac
cctcctatgggctacggacctcgcatacagcagccttccaacccgaaccagttccttccc
cagactccgttcccagcacagggaatgaatgtaacgaatatgcctttggctccgtctggc
ggtcaagcaccagtgtctcaagcacaaatgtccagtgtttcctgccctgtgaactctcct
ataatgcctccagggtctcaagggagccacattcactgtccccctctccctcaagctctg
catcagaattcaccctctcctgtacctagtcgtacccccacccctcaccacactccccca
agcataggggctcagcagccaccagcaacagtaattccagcccctgtccctacacctcca
gccatgccacctgggccacagtcccaggctctgcatccacctccaaggcagacacctaca
ccaccaccaacgcaacttcctccccaagcacaaccttcacttcctgctgctgcttccgcc
gaccagccacagcagcagcctctctcacagcagagtacggcagcatctgttcccaccccg
acggcaccactgctgcctccgcaacctgcgactccactttcccagccagctgtaagcatt
gaagggcaggtatcaaatcctccatctactagtagcacagaagtgaattctcagaccatt
cctgagaagcagccttcacaggaagtgaaaatggaggctaaaatggaagtggatcaacca
gaaccagcaactactcagccagaggatattccagagatgaaaacagaagactgtaaagta
gaacctatagaaacagaagagagaggcactgaattaaaaactgaaacaaaagaggaagaa
gacctgccaagtacttcagttacccagtcatctccagccccaggacagtcaaagaagaag
attttcaaaccagaggaattacgtcaggcactgatgccaacgttggaggcactttaccga
caggatccggaatcccttccttttcgtcagcctgtggaccctcagcttctaggaatccct
gattacttcgatattgtgaagagccccatggatctttctaccatcaagaggaagttagac
actggacagtatcaggagccctggcagtatgtggatgacatttggcttatgttcaacaat
gcctggttatataatcggaaaacatcgcgggtgtacaaatactgctccaagctgtctgag
gtctttgaacaagaaattgacccagtcatgcaaagccttggatattgttgtggcagaaag
ttggagttctctccacagacactctgttgctatggcaaacagttatgcacaatccctcgt
gatgccacttactacagttaccaaaacaggtatcatttctgtgagaagtgtttcaatgaa
atccaaggggagagcgtttctttgggggatgacccttcccagcctcaaactacaataaat
aaagaacaattttccaagagaaaaaatgacacactggatcctgaactatttgttgaatgt
acagaatgtggaagaaagatgcatcagatctgtgtccttcatcatgaggtcatctggcca
tctgggtttatctgtgatggctgtttaaagaaatctgcacgaactaggaaagaaaataag
ttttctgctaaaaggttgccatctaccaggctaggcacctttctggagaatcgtgtgaat
gaatttctgaggcgacaaaatcaccctgagtcaggagaggtcactgttcgggtagttcat
gcttctgacaaaaccgtggaagtcaaaccaggcatgaaagcaaggtttgtagatagtgga
gagatggcagaatcctttccgtatcgaaccaaagccctctttgcctttgaagagatcgat
ggtgttgacttatgcttctttggcatgcatgttcaagaatatggctccgactgccctcca
cccaatcagaggagagtatacatatcatacctcgatagtgttcatttcttccgtcctaaa
tgcttgagaactgcagtctaccatgaaattctgattggatatttagaatacgttaagaaa
ttaggttatacaacagggcatatttgggcatgtcccccaagtgagggagacgactatatc
ttccattgtcatcctcctgaccagaagatacccaagcctaagcgactgcaggaatggtac
aaaaagatgcttgacaaggccgtgtctgagcgaattgtccatgactacaaggatattttt
aaacaagctactgaagatcggttaacaagtgcaaaggaattgccttacttcgagggtgat
ttctggcccaatgtcctggaagagnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
naacgcgaggaaaacaccagcaatgagagcacggatgtgacaaagggagacagcaaaaat
gctaaaaagaaaaataataagaaaaccagcaaaaacaagagcagcctaagtaggggcaat
aagaagaagccaggcatgcccaatgtttccaatgacctctcgcagaaactgtatgccacc
atggagaaacataaagaggttttctttgtgatccgtctcatcgctggccctgccgccaac
tccctgccacccatcattgatcctgaccccctcatcccctgcgatctgatggatgggcgg
gatgcctttctcaccctcgcaagggacaagcacctggagttctcatccctccgaagagcc
cagtggtctaccatgtgcatgctggtggagctgcacacccagagccaggaccgcttcgtc
tacacctgcaacgagtgcaagcaccacgtggagacccgctggcactgcaccgtgtgtgag
gattacgatttgtgtatcacctgctataacactaaaaaccatgaccacaaaatggagaaa
ctaggtcttggcttggatgacgaaagcaacagccagcaggctgcagctacccagagccca
ggagactctcgccgcctgagcatccaacgctgcatccagtccctggtccatgcctgccag
tgccgaaatgccaactgctccctgccctcctgccagaagatgaagcgggttgtacaacac
accaagggttgcaaacggaaaaccaatggagggtgccccatctgcaagcagctcattgcc
ctctgctgctaccatgccaagcactgccaggagaacaagtgccctgtcccattctgcctg
aacatcaagcaaaagctccggcagcagcagctgcagcaccggctacagcaggcacagatg
ctccgaaggaggatggccagcatgcagcggaccggtgtggtggggcagcaacagggcctg
ccctcccccactcctgccactccgaccacgccaaccagccagcagcccaccaccccacag
acgcctcagcccccaccccctcctcagccccagcccacacctcccaacagcatgccgccc
tacttgcccaggactcaggctgctggccctgtgtcccagggtaaggcagcaggccaggtg
acccctccaacccctcctcagaccgctcagccaccccttccagggcccccacctgcagca
gtggaaatggcaatgcagattcagagggcggctgagacgcagcgccagatggcccacgtg
caaatttttcaaaggccgatccagcaccagatgcctcagatggctccaatggcccccata
ggtatgaacccacctcccatggccagaggtcccggtgggcatttggagccagggatggga
cccaccgggatgcaacaacagccaccgtgggcccaaggaggattgcctcagccccagcaa
ctacagaccgggatgcccaggccagccatgatgtcagtggcccaacatggtcagcccttg
aacatggctccccaaccaggactgggccaggtaggtgtgagccctctcaaaccaggcact
gtgtctcaacaagccttacaaaaccttttgcggactctcaggtctcccagctctccccta
cagcagcaacaggtgcttagtatccttcacgccaacccccagctgttggctgcattcatc
aagcagcgggctgccaagtatgccaactctaatccacagtccctccctgggcagcctggc
atgccccagggccagccagggctccagccccctgccatgccaggtcagcagggggtccac
tccaatccagccatgcagaacatgaatgccatgcaggcgggtgtccagagggccggcctt
cctcagcagcagccacagcagcaactgcagccgcccgtgggagggatgagcccccaggct
cagcaggtgaacatgaatcacaacgccatgccttcacagttccgagacatcttgagacga
cagcagatgatgcagcagcagcagcagcagggtgcagggccaggcattggccctgggatg
gccaaccataaccagtttcagcaaccccaaggggttggctaccccccacagcagcagcag
caacagcagcagcggatgcagcatcacatgcagcagatgcaacaagggaacatgggacca
atgggccagctcccccaggctctgggaccggaggcaggagccagtctgcaggtctatcag
cagcgactccttcagcaacagatggggtctcctgctcagcccaaccccatgagcccccaa
cagcatatgctcccgaatcaggctcagtccccacacctacaaggccagcagatcccttct
tctctctccaatcaagtgcgttctccccagcctgtccattctccacggccacagtctcag
cccccccactccagcccttccccaaggatgcaacctcagccttctccacaccacgtttcc
ccgcagaccagttctccacatccgggactggtagctgcccaggccaaccccatggaacaa
gggcactttgccagcccggaccagaattcgatgctttctcagctcactagcaatccaggc
atggcaaacctccatggtgcaagcgccacggacctgggactcagcaccgacaactcagac
ttgaattcaaccctctcacagagtacactagacatacactag

KEGG   Pteropus alecto (black flying fox): 102886172
Entry
102886172         CDS       T02993                                 

Gene name
CREBBP
Definition
(RefSeq) LOW QUALITY PROTEIN: CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04024  cAMP signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04310  Wnt signaling pathway
pale04330  Notch signaling pathway
pale04350  TGF-beta signaling pathway
pale04520  Adherens junction
pale04630  JAK-STAT signaling pathway
pale04720  Long-term potentiation
pale04916  Melanogenesis
pale04919  Thyroid hormone signaling pathway
pale04922  Glucagon signaling pathway
pale04935  Growth hormone synthesis, secretion and action
pale05016  Huntington disease
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05206  MicroRNAs in cancer
pale05211  Renal cell carcinoma
pale05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102886172 (CREBBP)
   04330 Notch signaling pathway
    102886172 (CREBBP)
   04350 TGF-beta signaling pathway
    102886172 (CREBBP)
   04630 JAK-STAT signaling pathway
    102886172 (CREBBP)
   04066 HIF-1 signaling pathway
    102886172 (CREBBP)
   04068 FoxO signaling pathway
    102886172 (CREBBP)
   04024 cAMP signaling pathway
    102886172 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102886172 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102886172 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102886172 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    102886172 (CREBBP)
   04919 Thyroid hormone signaling pathway
    102886172 (CREBBP)
   04916 Melanogenesis
    102886172 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    102886172 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102886172 (CREBBP)
   05206 MicroRNAs in cancer
    102886172 (CREBBP)
   05203 Viral carcinogenesis
    102886172 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102886172 (CREBBP)
   05215 Prostate cancer
    102886172 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102886172 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102886172 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102886172 (CREBBP)
   05161 Hepatitis B
    102886172 (CREBBP)
   05164 Influenza A
    102886172 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102886172 (CREBBP)
   05165 Human papillomavirus infection
    102886172 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102886172 (CREBBP)
   03036 Chromosome and associated proteins [BR:pale03036]
    102886172 (CREBBP)
   03029 Mitochondrial biogenesis [BR:pale03029]
    102886172 (CREBBP)
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102886172 (CREBBP)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    102886172 (CREBBP)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102886172 (CREBBP)
Mitochondrial biogenesis [BR:pale03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102886172 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 102886172
NCBI-ProteinID: XP_006913939
LinkDB
Position
Unknown
AA seq 2436 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGELGLLNSGNLVP
DAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNNANMASLGAMGKS
PLNQGDSSAPSLPKQAASTSGPTPPASQPLNPQAQKQVGLVTSSPATSQTGPGICMNANF
NQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGTTSSVLAE
TLTQVSPQIPSHAGLNTAQTGGMTKMGMTGNTSPFGQPFSQTGGQPMGAPGVNPQLPSKQ
NVVTSLPPFPADIKNASVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLL
LHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNAASLSNPNPIDPSSM
QRAYAALGLPYLNQSQTQLQTQVPGQQPAQPPAHQQMRTLNPLGNNPMNIPAGGITTDQQ
PPNLISESXXXXXXXTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSNTGVRKSWHEHVT
QDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEK
IYKIQKELEEKRRSRLHKQGILGNQPALPAPGAQPPGIPQPQPVRPPNGPMPLPVNRMQG
INSFNPMSLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHA
NNMMAQAPAQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQTGVSQGQVPGAALPNPLNMLG
PQASQLPCPPVTQSPLHQTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSSGQ
TPTPTPGSVPSASQAQSTPTVQAAAQVTPQPQTPVQPPSVATPQSSQQQPTPVHGQPPGT
PLSQAAASIDNRVPTPSSVASAETSSQQPGPDVPLEMKAEVKTEDIEPDAGEPKAEPGSA
MMEEDLQGSSQVKEESDTTEQKSEPMEVDEKKPEVKVEAKEEEESAANGAASQSASPSQP
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKR
KLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCC
GRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQT
TISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRK
ENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFV
DSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFF
RPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQ
EWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEE
EERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQK
LYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSS
LRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTH
KMVKWGLGLDDEGGSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKR
VVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQ
QAQLMRRRMATMNTRNVPQSLPSPTSAPPGTPTQQPSTPQTPQPPTQPQPSPVSMSPAGF
PSVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNGM
PPGRTGMVTPVSQMAPVGLNVPRPNQVSGPVMPNLPPGQWQQAPIPQQQPMPGMPRPVMS
MQAQPAVAGPRMPNVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFI
KQRTAKYVASQPGLQPQPGLQAQPGLQPQPGLHQQPGLQNLNAMQAGGPRPGVPPQQQPM
GGLNPQGQALNIMNPGHNPSMANMNPQYREMLRRQLLQQQQQQQQQQQQQQGSAGMAAGM
AGHGQFQQPQGPGGYPPAMQQQRMQQHLPMQGSSMGQMAAQMGQLSQMGQPGLGADSTPN
IQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRSP
APVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQS
AMLPQLNTPNRSALSNELSLVGDTTGDTLEKFVEGL
NT seq 7311 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaaagagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatccccaatggagaattaggccttttaaacagtgggaaccttgttcca
gatgctgcttccaaacataaacaactgtcggagcttctgcgtggaggcagtggctctagt
atcaacccaggaataggaaatgtgagtgccagcagcccggtgcagcaaggccttggtggc
caggctcaagggcagccgaacaatgcgaatatggccagcctgggtgccatgggcaagagc
cctctgaaccaaggagattcttcagcccccagcctgcccaagcaggcagccagcacctct
gggcccactccccctgcttcccaaccactgaatccgcaagcacaaaagcaagtggggctg
gtgaccagcagccctgccacatcgcagactggacctgggatctgcatgaatgctaacttt
aatcagacccacccaggcctccttaacagtaactcgggccatagtttaatgaaccaggcc
cagcaggggcaggcgcaagtcatgaatggatctctgggggctgctggcagaggaagagga
gctggaatgccgtaccctgctccagccatgcaggggaccacgagcagcgtgctggccgag
acgttaacacaggtttcgccgcaaattcccagtcacgcaggactgaacacggcacagacg
ggaggcatgaccaagatgggaatgactggtaacacaagtccctttggacaacccttcagt
caaactggagggcagccaatgggagcccccggagtgaacccccagttacccagcaaacag
aacgtggtcactagtttgcctcccttccctgcagacatcaagaatgcttcagtcaccaac
gtgccaaacatgtctcagatgcaaacatcagtgggaattgtacccacacaagcaattgca
acgggccccactgcagatccagaaaaacgcaaactgatacagcagcagctggttctactg
cttcacgctcataaatgtcagagacgagaacaagcaaacggagaggttcgggcctgctca
ctcccacattgccgaaccatgaaaaatgttttgaatcacatgacacattgtcaggctggg
aaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaac
tgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaac
caacaaaccatcctggggtctccagctagtggaattcagaacacaattggttctgttggt
acaggccagcagaatgctgcttctttaagtaacccaaatcccatagaccccagctccatg
cagcgagcatatgctgctcttggactcccctacctgaaccagtctcaaacgcagctgcag
actcaggttcctggtcagcaaccagcacagcctccagctcaccagcagatgaggactctc
aaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcagcag
ccaccaaacttgatttcagaatcannnnnnnnnnnnnnnnnnnngacctctcttggggcc
acaaacccactgatgaatgatggctccaactctggaaatatcggaaccctcagcactata
cctacagcagcacctccttctaatactggcgttcggaaaagctggcatgaacatgtcaca
caggacctgcggagccatctagtgcataaactcgtccaagccatcttcccaacacccgac
cctgcagctctgaaggatcgccgcatggagaacctagtggcctacgctaagaaagtagaa
ggggacatgtatgagtctgccaacagccgggatgaatactatcacttattagcagagaaa
atctacaagatacaaaaagaactagaagaaaaacgaaggtcacgtttacacaaacaaggc
atcttgggtaaccagccagccttaccagccccaggggcacagccccctgggattccacag
ccacaacctgtgagacctccaaatgggcccatgcccctgccagtgaatcgtatgcaaggg
ataaattcatttaatccgatgtccttggggaatgtacagttgccacaagctcccatggga
ccgcgcgcagcatcccccatgaaccactctgtcccaatgaacagcatgggctccgttcca
gggatggccatttctccttcccgaatgcctcagcctccaaacatgatgggtgcacatgcc
aacaacatgatggcccaggcacctgcgcagaaccagtttctgccacagaaccagttccca
tcatccagtggggcgatgagtgtgaacagtgtaggcatggggcaaccagcggcccagaca
ggcgtgtcacagggacaggtgcctggtgctgctcttcctaaccccttgaacatgcttggg
ccccaggctagccagctaccttgcccaccagtgacacaatcaccattgcaccagacgcca
cctcctgcttccacagctgctggcatgccatctctccagcatccgacggcacctgggatg
actcctccccagccagcagctcctacccagccatcaactcctgtctcgtcttccgggcag
actcccaccccaactcccggctcagtgcccagtgctagccaagcccagagcacccctaca
gtccaggcagcagcccaggtgaccccgcagcctcagaccccagtccagcccccatccgtg
gctacccctcagtcatctcagcagcagccgactcctgtgcatggccagcctcctggcaca
ccgctttcccaggcagcagccagcattgataacagggtccccactccatcctcagtggcc
agtgctgaaaccagctcccagcaaccaggacctgatgtaccactggaaatgaaggctgag
gtcaagaccgaggacattgagccagatgctggtgaacccaaggcagagcctgggtctgcg
atgatggaggaggatctacaaggatcttcccaagttaaagaagaatcagatacaacagag
cagaaatcagaaccaatggaagtggatgaaaagaagccagaagtaaaagtagaagctaaa
gaagaagaagagagtgccgctaatggtgccgcctcccagtcagcgtctccttcgcagcca
cgcaaaaaaatctttaagccggaggagttgcgccaggctcttatgccaaccctagaagca
ctgtatcgacaggatccagagtccttaccttttcggcagcctgtagatccccagctccta
ggaattccagattactttgacattgtgaagaaccccatggacctttccaccatcaagcgg
aagctggacacagggcagtaccaggaaccctggcagtacgtggacgatgtctggctgatg
ttcaacaatgcctggctctataatcgcaagacgtccagggtctataagttctgcagtaaa
ctggcagaggtctttgagcaagaaatcgaccctgttatgcagtctcttggatattgttgt
ggacgcaagtatgagttttccccacagactttgtgctgctatgggaagcagctctgtaca
attcctcgcgatgctgcctactacagctatcagaataggtatcatttctgtgagaagtgt
ttcacagagatccagggggagaatgttaccctgggtgacgacccttcacaaccccagacg
acaatttcaaaggatcagttcgaaaagaagaaaaatgataccttagatcctgaacctttt
gttgattgcaaggaatgtggccggaagatgcatcagatttgtgttttacactatgatatc
atttggccttcgggctttgtgtgcgacaactgcttgaagaaaactggcagaactcgaaaa
gaaaacaaattcagtgctaagagactacagaccacgcgattgggaaaccacttggaagac
cgagtcaacaagtttttgcggcgacaaaatcatcctgaagctggggaggtctttgtccga
gtggtggccagttcagacaagactgtggaggtcaagcctgggatgaagtcacggtttgtg
gactctggggaaatgtctgaatctttcccttatcgaaccaaagctctctttgcttttgag
gaaattgacggagtggatgtgtgcttttttgggatgcatgtccaggagtatggctctgat
tgccctcctccaaacacaaggcgtgtgtacatatcttatctggacagtattcatttcttc
cggccccgatgccttcggacagctgtttaccatgagatccttattggatatttagaatat
gtgaagaaattggggtatgtgacaggacacatctgggcctgtcccccaagtgaaggagat
gactacatcttccattgccacccccctgatcaaaaaatcccaaaaccgaagcgcctgcag
gagtggtacaagaagatgctagacaaggcgtttgcagaacgaatcatccatgactataag
gacattttcaaacaagcaactgaagacaggcttaccagtgccaaggaactgccctatttt
gagggtgacttctggcccaatgtgttggaggagagtattaaggagctagaacaagaagaa
gaagagagaaagaaagaagagagcactgcagccagtgagacgacggagggcagccagggt
gacagcaagaatgccaagaaaaagaacaacaagaaaaccaacaagaataaaagcagcatc
agccgagccaacaagaagaagcccagcatgcccaacgtgtccaacgacttatctcagaaa
ctctatgccaccatggagaagcacaaagaggtcttctttgtgatccaccttcatgcaggg
cctgttatcaatacactgccccccattgttgaccccgaccccttgctcagctgtgacctc
atggatgggcgcgacgccttcctcaccctcgccagagataagcactgggagttctcctcc
ctgcgtcggtccaagtggtccacgctgtgcatgctggtggagctgcacacccagggccaa
gaccgcttcgtctacacttgcaacgagtgcaagcatcacgtggagacccgctggcactgc
accgtgtgtgaggactacgatctttgtatcaactgctacaacacgaagagccacacacac
aagatggtgaagtgggggctgggcctagacgacgagggcggcagccagggtgagccacag
tccaagagcccccaggagtcacggcgcctgagcatccagcgctgcatccagtccctagtg
cacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccagaagatgaagcgg
gttgtgcaacataccaagggctgtaagcgcaagaccaacggaggctgcccggtatgcaag
cagctcatcgccctttgctgctatcatgccaaacactgccaagaaaataaatgccctgtg
cccttctgcctcaacatcaaacacaagctccgccagcagcagatacagcaccgcctacag
caagcgcagctcatgcgccggcggatggccaccatgaacacccgcaacgtgcctcagagt
ctgccttcccctacctcagcaccgcccgggacccccacccagcagcccagcacaccccag
acaccacagccccccacccagccccagccttcacctgtgagcatgtcaccagccggcttc
cctagcgtggcccggactcagccccccaccacggtgtccactgggaagcccaccaaccag
gtgccagccccaccgccccctgcccagcccccacccgcagcagtggaggcggcccggcag
attgagcgcgaggctcagcagcagcagcacctgtaccgggtgaacatcaacaatggcatg
cccccagggcgcacgggcatggtgaccccagtgagccagatggctcctgtgggcctgaat
gtgccccgacccaaccaagtcagtgggcctgtcatgcccaacctgccccctgggcagtgg
cagcaggcgcccatcccccagcagcagccgatgccgggcatgcctagaccagtgatgtcc
atgcaggcccagccagctgtggctgggccacggatgcccaatgtgcagccaccccggagc
atctcacctggtgccctgcaggacctgttgcggaccctgaagtctcccagctccccgcag
cagcagcagcaggtgctcaacatcctcaagtcaaaccctcagctgatggcagctttcatt
aaacagcgcacagccaagtacgtggccagtcaacccggcctccagccccaacccggcctc
caggcccagcctggcctgcagccccagcccggtctgcaccagcagcctggcctgcagaac
ctgaatgccatgcaagctggcggtccacggcctggcgtgcctccacagcagcagccaatg
ggaggcctgaacccccagggccaggccttgaacatcatgaacccagggcacaaccccagc
atggcgaatatgaacccgcagtacagagagatgctgcggaggcagctgctgcagcagcaa
cagcagcagcagcagcagcaacagcaacagcagggcagcgcgggcatggccgcaggcatg
gcagggcatggccagttccagcagcctcaaggacccggaggctaccctccggccatgcag
cagcagcggatgcagcagcacctcccaatgcagggcagctccatgggccagatggcagct
cagatgggacagcttagccagatggggcagcccgggctgggtgcagacagcacccccaac
atccagcaggccctgcagcagcggattctgcagcagcagcagatgaagcagcagattggg
tcccccggccagccgaaccccatgagcccccagcaacacatgctctcaggacagccacag
gcctcgcacctccccggccagcagatggccacgtcccttagtagccaggtgaggtctccg
gcccctgtacagtctccgcggccccagtcccagcctccacattccagcccgtcgccacgg
atacagccccagccttcaccacaccatgtctcaccccagactggttccccccaccccgga
ctcgcagtcaccatggccagctctatagatcagggacacttggggaaccccgaacagagt
gcaatgctcccacagctgaacacccccaacaggagtgcattgtccaatgagctgtccttg
gtcggtgacaccacaggagacaccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system