KEGG   Pteropus alecto (black flying fox): 102881295
Entry
102881295         CDS       T02993                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X2
  KO
K13376  transforming growth factor beta-2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04060  Cytokine-cytokine receptor interaction
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04218  Cellular senescence
pale04350  TGF-beta signaling pathway
pale04380  Osteoclast differentiation
pale04390  Hippo signaling pathway
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05144  Malaria
pale05145  Toxoplasmosis
pale05146  Amoebiasis
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05220  Chronic myeloid leukemia
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05321  Inflammatory bowel disease
pale05323  Rheumatoid arthritis
pale05410  Hypertrophic cardiomyopathy
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102881295 (TGFB2)
   04350 TGF-beta signaling pathway
    102881295 (TGFB2)
   04390 Hippo signaling pathway
    102881295 (TGFB2)
   04068 FoxO signaling pathway
    102881295 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102881295 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102881295 (TGFB2)
   04218 Cellular senescence
    102881295 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102881295 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102881295 (TGFB2)
   05206 MicroRNAs in cancer
    102881295 (TGFB2)
   05205 Proteoglycans in cancer
    102881295 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102881295 (TGFB2)
   05212 Pancreatic cancer
    102881295 (TGFB2)
   05225 Hepatocellular carcinoma
    102881295 (TGFB2)
   05226 Gastric cancer
    102881295 (TGFB2)
   05220 Chronic myeloid leukemia
    102881295 (TGFB2)
   05211 Renal cell carcinoma
    102881295 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102881295 (TGFB2)
   05321 Inflammatory bowel disease
    102881295 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102881295 (TGFB2)
   05414 Dilated cardiomyopathy
    102881295 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102881295 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102881295 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102881295 (TGFB2)
   05161 Hepatitis B
    102881295 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102881295 (TGFB2)
   05144 Malaria
    102881295 (TGFB2)
   05145 Toxoplasmosis
    102881295 (TGFB2)
   05140 Leishmaniasis
    102881295 (TGFB2)
   05142 Chagas disease
    102881295 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102881295 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102881295 (TGFB2)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102881295 (TGFB2)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102881295 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102881295
NCBI-ProteinID: XP_006916290
UniProt: L5KB86
LinkDB
Position
Unknown
AA seq 414 aa
MHYWVLRGLLLLHLVAAALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDHPEP
EDVPAEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIEMPPFYPAENTIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVAEQRIELYQILKSKDLTSP
AQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQSNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgcactactgggtgctgcgaggtctgctgctgctgcatctggtcgcggccgcgctcagc
ctgtctacctgcagcacgctggacatggaccagttcatgcgtaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccggaggaccaccccgagccc
gaggacgtgcccgccgaggtgatctccatctacaacagcaccagggacctgctgcaggag
aaggcgagccgccgggcggccgcctgcgagcgcgagcgcagcgacgaggagtactacgcc
aaggaggtgtacaagatcgagatgccgcccttctaccccgccgaaaataccatcccgccc
actttctacagaccctacttcaggattgtccgattcgacgtctcagcgatggagaaaaat
gcttctaatttggtgaaagcggagtttagagtctttcgtttacagaaccccaaagccagg
gtggccgaacaacgcatcgagctgtaccagatcctcaaatccaaagatttgacgtccccg
gcccagcgctacatcgacagcaaagtcgtgaagaccagggcagagggcgaatggctgtcc
ttcgacgtgacggatgctgttcacgaatggctccaccacaaagacagaaacctgggattt
aaaataagtttacattgcccctgctgcaccttcgtgccgtctaacaattacatcatcccc
aataaaagcgaagaactagaagcaagattcgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacac
ctcctgctaatgttgttgccctcctacagactggagtcacaacagtccaatcggcggaag
aagcgtgctctggacgcagcctattgttttagaaatgttcaggataattgctgcctgcgt
cctctttacattgatttcaagagggatcttgggtggaaatggatccatgagcccaaaggg
tacaacgccaacttctgtgctggggcgtgcccgtacttatggagttcagacactcagcac
agcagggttctcagcttatacaataccataaatccagaagcatctgcttccccttgctgc
gtgtcccaggatttagagccgctaaccattctctactacatcggcaaaacacccaagatc
gaacagctttctaacatgatcgtaaagtcttgcaaatgcagctaa

KEGG   Pteropus alecto (black flying fox): 102884154
Entry
102884154         CDS       T02993                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04060  Cytokine-cytokine receptor interaction
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04218  Cellular senescence
pale04350  TGF-beta signaling pathway
pale04380  Osteoclast differentiation
pale04390  Hippo signaling pathway
pale04659  Th17 cell differentiation
pale04672  Intestinal immune network for IgA production
pale04926  Relaxin signaling pathway
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05144  Malaria
pale05145  Toxoplasmosis
pale05146  Amoebiasis
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05220  Chronic myeloid leukemia
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05321  Inflammatory bowel disease
pale05323  Rheumatoid arthritis
pale05410  Hypertrophic cardiomyopathy
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102884154 (TGFB1)
   04350 TGF-beta signaling pathway
    102884154 (TGFB1)
   04390 Hippo signaling pathway
    102884154 (TGFB1)
   04068 FoxO signaling pathway
    102884154 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102884154 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102884154 (TGFB1)
   04218 Cellular senescence
    102884154 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102884154 (TGFB1)
   04672 Intestinal immune network for IgA production
    102884154 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102884154 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102884154 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102884154 (TGFB1)
   05205 Proteoglycans in cancer
    102884154 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102884154 (TGFB1)
   05212 Pancreatic cancer
    102884154 (TGFB1)
   05225 Hepatocellular carcinoma
    102884154 (TGFB1)
   05226 Gastric cancer
    102884154 (TGFB1)
   05220 Chronic myeloid leukemia
    102884154 (TGFB1)
   05211 Renal cell carcinoma
    102884154 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102884154 (TGFB1)
   05321 Inflammatory bowel disease
    102884154 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102884154 (TGFB1)
   05414 Dilated cardiomyopathy
    102884154 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102884154 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102884154 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102884154 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102884154 (TGFB1)
   05161 Hepatitis B
    102884154 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102884154 (TGFB1)
   05144 Malaria
    102884154 (TGFB1)
   05145 Toxoplasmosis
    102884154 (TGFB1)
   05140 Leishmaniasis
    102884154 (TGFB1)
   05142 Chagas disease
    102884154 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pale03110]
    102884154 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102884154 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102884154 (TGFB1)
Chaperones and folding catalysts [BR:pale03110]
 Intramolecular chaperones
  Others
   102884154 (TGFB1)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102884154 (TGFB1)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102884154 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102884154
NCBI-ProteinID: XP_006910764
LinkDB
Position
Unknown
AA seq 369 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPESVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLTVENTHKI
YETYKHNSHSIYMFFNTSELREAVSEPELLSRAELRMQRHKLKVEQHVELYQKYSNGSWR
YLSNQLLAPSDTPEWLSFEVTGVVRQWLSHKGEIEGFRLSAHCSCDNKDDILHVEINGIS
TDRRGDLATIHGINRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGAQTLTISVFHV
ILVNTRFIY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctcttgccgctgctgctgccgctgctgtggctactagtg
ctgacgcctggccggccggccgccggactatccacctgcaagaccatcgacatggagctg
gtgaagaggaagcgcatcgaggccatccgcggccagatcctatccaagctgcgactcgcc
agtcccccgagtcagggggaggtgccgcccggcccgctgcccgagtccgtgctggccctt
tacaacagtacccgtgaccgggtggccggggagagcgcagagccggagcccgaaccggag
gcggactactacgccaaggaggtcacccgcgtgctaaccgtggaaaacacccacaaaatc
tacgagacatacaagcataattcacacagcatatacatgttcttcaacacgtccgagctc
cgggaagcggtgtcggaacccgagttgctctcccgagcagagctgcgtatgcagaggcac
aaattgaaagtggagcagcatgtggagctgtaccagaaatacagcaacggttcctggcgc
tacctcagcaaccagctcctggcccccagcgacacgcctgagtggctgtcctttgaggtc
actggagtagtgcggcagtggctgagtcacaaaggggaaattgagggctttcgcctcagt
gcccactgctcctgtgacaacaaagatgacatacttcatgtggaaatcaatggaatcagt
acggaccgccggggagacctggccaccattcatggcataaaccggcccttcctgctcctc
atggccacccctctggagagagcccagcacctgcacagttcccggcaccgccgagccctg
gacaccaactactgcttcagctccacggagaagaactgctgtgtgcggcagctttacatt
gacttccgcaaggacctgggctggaagtggatccacgagcccaagggctaccatgccaac
ttctgcctcgggccctgtccctacatttggagcctggacacgcagtacagcaaggtcctg
gccctgtacaaccagcacaaccccggcgcgcaaacactgaccatttctgtgttccatgtg
atcctggtgaacaccagatttatttactga

KEGG   Pteropus alecto (black flying fox): 102893304
Entry
102893304         CDS       T02993                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04060  Cytokine-cytokine receptor interaction
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04218  Cellular senescence
pale04350  TGF-beta signaling pathway
pale04390  Hippo signaling pathway
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05144  Malaria
pale05145  Toxoplasmosis
pale05146  Amoebiasis
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05220  Chronic myeloid leukemia
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05321  Inflammatory bowel disease
pale05323  Rheumatoid arthritis
pale05410  Hypertrophic cardiomyopathy
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102893304 (TGFB3)
   04350 TGF-beta signaling pathway
    102893304 (TGFB3)
   04390 Hippo signaling pathway
    102893304 (TGFB3)
   04068 FoxO signaling pathway
    102893304 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102893304 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102893304 (TGFB3)
   04218 Cellular senescence
    102893304 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102893304 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102893304 (TGFB3)
   05212 Pancreatic cancer
    102893304 (TGFB3)
   05225 Hepatocellular carcinoma
    102893304 (TGFB3)
   05226 Gastric cancer
    102893304 (TGFB3)
   05220 Chronic myeloid leukemia
    102893304 (TGFB3)
   05211 Renal cell carcinoma
    102893304 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102893304 (TGFB3)
   05321 Inflammatory bowel disease
    102893304 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102893304 (TGFB3)
   05414 Dilated cardiomyopathy
    102893304 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102893304 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102893304 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102893304 (TGFB3)
   05161 Hepatitis B
    102893304 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102893304 (TGFB3)
   05144 Malaria
    102893304 (TGFB3)
   05145 Toxoplasmosis
    102893304 (TGFB3)
   05140 Leishmaniasis
    102893304 (TGFB3)
   05142 Chagas disease
    102893304 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102893304 (TGFB3)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102893304 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102893304
NCBI-ProteinID: XP_006925690
LinkDB
Position
Unknown
AA seq 347 aa
MTHVPYQILALYNSTRELLEEREDGCTQENTEWEYYAKEIHKFDMIQGLAEHNELAVCPK
GITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRY
IGGKNLPTRGTAEWLSFDVTDTVREWLSRRESNLGLEISIHCPCHTFQPNGDILENIHEV
MEIKFKGVDSEDDHGRGDLGRLRKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKRALDTN
YCFSNVEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSKVLGLY
NTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEHLSNMVVKSCKCS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgacccacgtcccctaccagatcctggccctttacaacagcacccgggagctgctagag
gagagggaggacggctgcactcaggaaaacaccgagtgggagtactatgccaaagaaatc
cataaattcgacatgatccaggggctggcggagcacaacgagctggctgtctgccccaaa
ggaatcacctccaaggttttccgcttcaacgtgtcctcagtggagaaaaacggaaccaac
ctgttccgagcagaattccgggtcttgcgggtgcccaaccccagctccaagcgcaatgag
cagaggatcgagctcttccagatactccggccagatgagcacatcgccaaacagcgctat
attggtggcaagaatctgcccacgcggggcactgctgagtggctgtcttttgatgtcact
gacactgtgcgtgaatggctctcacgaagagagtccaacttaggtctggaaatcagtatt
cattgtccatgtcacacctttcagcccaatggagatatcctggaaaacattcatgaggtg
atggaaatcaaattcaaaggcgtggacagtgaggatgatcatggccgtggagatctgggg
cgcctcaggaagcagaaggaccaccacaaccctcatctaatcctcatgatgattcctcca
catcggcttgacaacccgggccaggggggtcagaggaagaagcgggccctggacacgaat
tactgcttcagcaacgtggaggagaactgctgtgtgcgccctctctacattgactttcga
caggatctgggttggaaatgggtccatgaacctaagggatattacgccaacttctgctca
ggcccttgcccatacctccgcagtgcagacacaacccacagcaaggtgctgggcctgtac
aacaccttgaatcctgaagcatcggcctcgccttgctgcgtgccccaggacttggagccc
ctgaccatcctgtactatgtcgggaggacccccaaggtggaacatctctctaatatggtg
gtgaagtcctgtaagtgtagctga

DBGET integrated database retrieval system