KEGG   Pteropus alecto (black flying fox): 102881382Help
Entry
102881382         CDS       T02993                                 

Gene name
ZBTB16
Definition
(RefSeq) zinc finger and BTB domain-containing protein 16 isoform X1
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pale00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102881382 (ZBTB16)
   05202 Transcriptional misregulation in cancer
    102881382 (ZBTB16)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102881382 (ZBTB16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102881382 (ZBTB16)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     102881382 (ZBTB16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 BTB zf-met zf-C2H2_jaz zf-C2H2_6 zf-C2H2_2 zf-C2H2_11 zinc_ribbon_15 zf_UBZ MIX
Motif
Other DBs
NCBI-GeneID: 102881382
NCBI-ProteinID: XP_006912856
LinkDB All DBs
Position
Unknown
AA seq 673 aa AA seqDB search
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
ILETIQATDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAAQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLGGGGRHPGVAE
VKTEMMQVDEVPGQDSPGAAESSISGGIGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQLPPPAEAGQVPPVRPEHPAPTAEKHLGIYSVLPNHKAEAVLSMPSSVSSGLHVQP
TLAVSMDFSTYGGLLPQGFIQRELFNKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECDRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggatctgacgaagatgggcatgatccagctgcagaaccccagccaccccacagggctc
ctgtgcaaggccaaccagatgcggctggctgggacactgtgtgatgtggtcatcatggtg
gacagccaggagttccacgcccaccggaccgtgctggcctgcaccagcaagatgtttgag
atcctcttccaccgcaacagccagcactacactctggacttcctctcgccaaagaccttc
cagcagattctggaatatgcatacacagccacattgcaagccaaggcagaggacctggat
gatctgctgtatgcggctgagatcttggagatcgagtacctagaggaacagtgcctgaag
atcctggagaccatccaggccacagatgacaatgacacggaggccaccatggcagatggc
ggggccgaggaggaagaggaccgaaaggctcggtacctcaagaacatcttcatctcaaag
cattccagcgaggagagtgggtatgccagtgtggctgcacagagtctccctgggcccatg
gtggaccagagcccttcagtctccacctcatttggtctttcagccatgagtcccaccaaa
gctgcagtggacagtttgatgaccataggacagtctctcctgcagggaactcttcagcca
cctgcagggcctgaggagccgactctgggtgggggtgggcggcacccgggggtggctgag
gtaaagacagagatgatgcaggtggatgaggttcctggccaggacagccctggggcagct
gagtctagcatctcaggcgggattggggacaaggtcgaggaaaggggcaaagaggggcca
gggaccccgactcggagcagcgtcatcaccagtgctagggagctgcactacgggcgggag
gagagtgctgagcagttgccaccccctgctgaggctggccaggtccccccagtccgaccg
gagcacccggcacccacagccgagaaacatctaggcatctactctgtgttgcccaaccac
aaggctgaggccgtgttgagcatgccatcttcggtgtcctctggcctccatgtgcagccc
acactggccgtctccatggacttcagcacctatgggggtctgctgccacagggcttcatc
cagagggagctgttcaacaagctgggtgagctggccgtgggcatgaagtcggagagtcgg
accatcggggagcagtgcagcgtgtgtggggtggaacttcctgacaacgaggctgtggag
cagcacaggaagctgcacagtgggatgaagacgtacgggtgtgagctctgcggaaagcgg
ttcctggatagtttgcgactgagaatgcacttactggctcattcagcgggtgccaaagcc
tttgtctgtgatcagtgcggtgcccagttttcgaaggaggatgccctggagacacacagg
cagacccatactggcacagacatggccgtcttctgtctgctgtgcgggaagcgtttccag
gcacagagcgcgctccagcagcacatggaggtccacgcaggcgtgcgcagctacatctgc
agcgagtgtgaccgcaccttccccagccacaccgccctcaaacgccacctgcgctcacac
acaggcgaccacccgtacgagtgtgagttctgtggcagctgcttccgggatgagagcacg
ctcaagagccacaaacgcatccacacaggcgagaaaccctacgagtgcaatgggtgtggc
aagaagttcagcctcaagcaccaactggagacgcactatagggtgcatacaggcgagaag
cccttcgagtgtaagctctgccaccagcgctcccgggactactcggccatgatcaagcac
ctgaggacgcacaacggcgcctccccctaccagtgcaccatctgcacggagtactgcccc
agcctctcctccatgcagaagcacatgaagggccacaagcccgaggagatcccgcccgac
tggaggatagagaagacttacctctacctgtgctacgtgtga

DBGET integrated database retrieval system