KEGG   Pteropus alecto (black flying fox): 102881410
Entry
102881410         CDS       T02993                                 

Gene name
STK4
Definition
(RefSeq) serine/threonine-protein kinase 4 isoform X1
  KO
K04411  serine/threonine kinase 4
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04068  FoxO signaling pathway
pale05200  Pathways in cancer
pale05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102881410 (STK4)
   04014 Ras signaling pathway
    102881410 (STK4)
   04068 FoxO signaling pathway
    102881410 (STK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102881410 (STK4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102881410 (STK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102881410 (STK4)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: STE group
  STE20 family
   102881410 (STK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH Pkinase_fungal Abi_2 Haspin_kinase DUF4611 Prothymosin
Other DBs
NCBI-GeneID: 102881410
NCBI-ProteinID: XP_006921907
LinkDB
Position
Unknown
AA seq 487 aa
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFVKSAKGVSILRDLINEAMDV
KLKRQEAQQREVDQDDEENSEEDEMDSGTMVRAAGDEMGTVRVASTMSDGANTMIEHDDT
LPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLK
SSSDWKVPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggagacggtgcagctcaggaacccgccgcgccggcagctgaaaaagttggatgaagat
agtttaactaaacaaccagaagaagtgtttgatgtcttagagaaacttggagaagggtcc
tatggcagcgtatacaaagctattcataaagagacgggtcagattgtggccattaagcaa
gttcctgtggaatccgacctgcaggagataatcaaagagatctctataatgcagcaatgt
gacagccctcatgtagtcaaatattatggcagttattttaagaacacagacttgtggatt
gtaatggagtactgcggggctggttcagtgtctgatatcattcgattacgaaataaaacg
ttaacagaagatgaaatagctacaatattacaatcaacgcttaagggactggaatacctt
cattttatgaggaaaatacaccgagatatcaaggcaggaaatattttgctaaatacggaa
ggacatgcaaaacttgcagattttggggtagcaggtcaacttacagataccatggccaag
cgaaatacagtgataggaacaccgttttggatggctccagaagtgattcaggaaattggg
tacaactgtgtggcagacatctggtcattgggaataactgccatagaaatggctgaagga
aagcccccatatgctgatatccatccaatgagggcaatcttcatgattcctaccaaccct
cctcccacatttcgaaagccagaactgtggtcagataacttcatggattttgtgaagcag
tgtcttgtaaagagccctgagcagagagccacagccactcaactcctacagcacccattt
gtcaagagtgccaaaggagtgtcgatactgcgggacttaattaatgaagccatggacgtg
aaactgaaacgccaggaagcccagcagcgggaggtggaccaggatgatgaagaaaactca
gaggaggatgaaatggattctggcacgatggttcgagcagcaggtgatgagatgggcact
gtccgagtagccagcaccatgagtgatggagccaatactatgattgagcacgatgacaca
ttgccatcacagctgggcaccatggtgatcaatgcagaggatgaggaagaggaagggact
atgaaaagaagggatgagaccatgcagcctgcaaaaccatctttccttgaatattttgaa
caaaaagaaaaggaaaaccagatcaacagctttggcaagagtgtacctggcccactgaag
agctcttcagattggaaagtcccacaggatggagactatgagttccttaagagttggaca
gtggaggaccttcagaagaggctcctggccctcgaccccatgatggagcaggagatcgaa
gagatccggcagaagtaccagtccaagcggcagccgatcctggatgccatcgaggctaag
aagcggcggcagcaaaacttctga

DBGET integrated database retrieval system