KEGG   Pteropus alecto (black flying fox): 102881535
Entry
102881535         CDS       T02993                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase type 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale01100  Metabolic pathways
pale01522  Endocrine resistance
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04072  Phospholipase D signaling pathway
pale04114  Oocyte meiosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04713  Circadian entrainment
pale04714  Thermogenesis
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04727  GABAergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04913  Ovarian steroidogenesis
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04921  Oxytocin signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04976  Bile secretion
pale05032  Morphine addiction
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102881535 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102881535 (ADCY7)
   04371 Apelin signaling pathway
    102881535 (ADCY7)
   04020 Calcium signaling pathway
    102881535 (ADCY7)
   04072 Phospholipase D signaling pathway
    102881535 (ADCY7)
   04024 cAMP signaling pathway
    102881535 (ADCY7)
   04022 cGMP-PKG signaling pathway
    102881535 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102881535 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102881535 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102881535 (ADCY7)
   04062 Chemokine signaling pathway
    102881535 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    102881535 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    102881535 (ADCY7)
   04912 GnRH signaling pathway
    102881535 (ADCY7)
   04913 Ovarian steroidogenesis
    102881535 (ADCY7)
   04915 Estrogen signaling pathway
    102881535 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    102881535 (ADCY7)
   04921 Oxytocin signaling pathway
    102881535 (ADCY7)
   04926 Relaxin signaling pathway
    102881535 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    102881535 (ADCY7)
   04918 Thyroid hormone synthesis
    102881535 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    102881535 (ADCY7)
   04916 Melanogenesis
    102881535 (ADCY7)
   04925 Aldosterone synthesis and secretion
    102881535 (ADCY7)
   04927 Cortisol synthesis and secretion
    102881535 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102881535 (ADCY7)
   04270 Vascular smooth muscle contraction
    102881535 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    102881535 (ADCY7)
   04971 Gastric acid secretion
    102881535 (ADCY7)
   04972 Pancreatic secretion
    102881535 (ADCY7)
   04976 Bile secretion
    102881535 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    102881535 (ADCY7)
   04727 GABAergic synapse
    102881535 (ADCY7)
   04725 Cholinergic synapse
    102881535 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    102881535 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102881535 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    102881535 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    102881535 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102881535 (ADCY7)
   04714 Thermogenesis
    102881535 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102881535 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    102881535 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102881535 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102881535 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102881535 (ADCY7)
   05163 Human cytomegalovirus infection
    102881535 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102881535 (ADCY7)
Enzymes [BR:pale01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102881535 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF484
Other DBs
NCBI-GeneID: 102881535
NCBI-ProteinID: XP_024900361
LinkDB
Position
Unknown
AA seq 1104 aa
MPAKGRYFLNEGEAGPDHDVLYEKYRLTSQHGPLLLTLLLVAVAACTALVVLAFGSGDPS
RHKAVLGTAFLTLIVFVALYVLVYIECLVRRWLWASALLTWACLVTLGYVLVFDSWTNAA
CGWEQVPFFLFVVFVVYTLLPFSMQGAVAAGIVSSTSHLLVLGTLMGVFSKPSTRVGLQL
LANAVIFLCGNLTGAFHKHQMQDASHDLFTYTVKCIQIRRKLRIEKRQNVASLLSVLPAH
ISMGMKLTIIERLKERGDRHSVPDNNFHSLYVKRHQNVSILYADIVGFTRLASDCSPKEL
VVMLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDICEAIKQ
VREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LNHLDKAYEVEDGHGQQRDSYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGEAALKMRA
SVRMTRYLESWGAARPFAHLSHVGRVPAPRPCPASLPRVPPSWDVQACGERSRGCDVPVR
LVQSGSGEPAAGTVSSTLSFWTTMAFSPPFQVIPLRRHRTPDRSASPKGRSEDDSYDDEM
LSAIEGLSSTRPCCSKSDDFYTFGSIFLEKDFEREYRLAPIPRARHYFACASLIFLCILL
VHVLLMPRTAALGMSFGLVACVLGLVLGLCFADEFLYYTCSCILAFVACSVFLRMSLELK
VVLLTVALVAYLVLFNVDRCAPPSLQYYTCSCILAFVACSVFLRMSLELKVVLLTVALVA
YLVLFNVSLCSRWDCCDSLGNLTKTNDTLSPSVCSWRDLKTTICFYLVLFYTTLILLSRQ
IDYYCRLDCLWKNKFKKEQEEFETMENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYD
CVSVMFASVPDFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSSVEKIKTIGST
YMAAAGLSVPSGHENQDWERRHAHVGIAVEFSTALMSKLDGINRHSFNSFRLRVGINHGP
VIAGVIGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCAILQGLGYSCECRGLINV
KGKGELRTYFVCTDTGKFQGLGLN
NT seq 3315 nt   +upstreamnt  +downstreamnt
atgccggccaagggacgctacttcctcaacgagggcgaggcgggcccggaccacgacgtg
ctctacgagaagtatcgcctcaccagccagcatgggccgctgctgctcacgctcctgctg
gtggccgtggccgcctgcacggccctcgtcgtcctcgccttcggctccggggatccctcc
agacacaaggctgtgttggggacggcgttcttgacgctcatcgtgttcgtggctctctac
gtgctggtgtacatcgagtgccttgtccggcggtggctctgggcctcggcactgctcacc
tgggcctgccttgtgacgctgggctatgtgctggtgttcgactcatggacgaacgcggcc
tgcgggtgggagcaggtgcccttcttcctgttcgtcgtcttcgtggtgtacacgctcctg
cccttcagcatgcagggggccgtggcggccggcatcgtctccagcacctcccacctgctg
gtgctgggcaccctgatgggcgtcttctcgaagcccagcacccgggtggggctgcagctg
ctggccaacgctgtcatcttcctgtgcgggaacctcacgggcgccttccacaagcaccag
atgcaggacgcctcccacgacctcttcacctacaccgtgaagtgcatccagatccgccgc
aagctgcgcatcgagaagcgccagaatgtggcttccttgctgtcggtgctgccggcccac
atctccatgggcatgaagctgaccatcatcgagcggctcaaggagcgtggggaccgccac
tccgtgcccgacaacaacttccacagcctctacgtcaagcggcaccagaacgtcagcatc
ctctacgcggacatcgtgggcttcacgcggctggccagcgactgttcccccaaagagctg
gtggtgatgctgaatgagctcttcggcaagttcgaccagatcgcgaaggccaacgagtgc
atgcggatcaagatcttgggcgactgctactactgtgtgtcgggcttgcccgtgtccctg
cccacccacgcccggaactgtgtgaagatggggctggacatctgcgaggccattaagcag
gtgcgggaggccacgggcgtggacatcagcatgcgcgtgggcatccactccgggaacgtg
ctgtgcggcgtcattggcctccgcaagtggcagtatgacgtgtggtcccacgacgtgtcc
ctcgccaataggatggaggcggccggagtccctggccgagtgcacatcacggaggcgacg
ctgaaccacctggacaaggcgtacgaggtggaggatggacacggccagcagcgcgactcc
tacctgaaggagatgaacatccgcacgtacctggtcatcgacccccggagccagcagcca
ccgccaccgagccagcacctccccaggcccaagggagaggcggcgctgaagatgcgggcg
tccgtgcgcatgacccgctacctggagtcctggggcgccgcgcggccctttgcccacctc
agccacgtgggccgcgtccctgccccgcgtccctgccccgcgtccctgccccgcgtccct
ccctcctgggacgtgcaggcgtgtggggaacgctcccggggctgcgatgtccccgtccgc
ctcgttcagtctgggtctggggagcctgcagctgggacagtgtccagcaccctctcgttc
tggacaacgatggccttttctcctcccttccaggtcatccccctgcgacgccaccggacc
cctgacagaagcgcatccccgaaggggcggtccgaggatgactcgtacgatgacgagatg
ctgtcggccattgagggcctcagctctaccaggccctgctgctccaagtctgatgacttt
tatacctttgggtccatcttcctggagaaagactttgagcgagagtaccgcctggcgccc
atcccccgggcccgccactacttcgcctgtgccagcctcatcttcctctgcatcctgctc
gtccacgtcctgctgatgcccaggactgcggctctgggcatgtcctttgggctggtggcc
tgtgtgctggggctggtgctgggactgtgctttgccgacgagttcctgtattacacctgc
agctgcatcctggcctttgtcgcctgttctgtcttcctgcggatgagcctggagctgaaa
gtcgtgctgttgacagtggccttggtggcctacctggtgctcttcaatgtcgaccgctgc
gcacccccgtctctgcagtattacacctgcagctgcatcctggcctttgtcgcctgttct
gtcttcctgcggatgagcctggagctgaaagtcgtgctgttgacagtggccttggtggcc
tacctggtgctcttcaatgtctccctgtgctcacggtgggactgctgtgacagcctgggc
aacctcaccaagaccaacgacaccctcagcccctcggtctgttcatggagggatctgaag
accacgatctgcttctacctggttctgttttacaccacgctcatcctgctctccagacag
atcgattattactgccgcctggactgtctgtggaagaacaagttcaagaaggagcaagag
gagttcgaaaccatggagaacgtgaaccgcctccttctggagaacgtcctgccagcccac
gtggccgcccacttcattggcgacaagttaaatgaggactggtaccatcagtcctacgac
tgtgtctctgtcatgttcgcgtccgtgccggacttcaaggtcttctacacggagtgcgac
gtcaacaaggaggggctggagtgcctgcgcctgctcaacgagatcattgctgactttgac
gagctgctgttgaagcccaagttcagcagcgtagagaagatcaagaccatcggcagcacc
tacatggcagctgcggggctcagcgtcccctcagggcacgagaaccaggactgggagcgg
cggcacgcgcacgtgggcatcgcggtggagttcagcaccgccctgatgagcaagctggac
ggcatcaacaggcactcgttcaactccttccgcctccgcgtcggcataaaccacgggccc
gtgatcgcgggagtgatcggggcgcggaaacctcagtacgacatctggggaaacacggtc
aacgtcgccagccgaatggagagcactggagagctcgggaaaatccaggtgacggaagag
acgtgcgccatcctccagggactgggttattcttgcgagtgccgtgggctgatcaacgtc
aagggcaaaggtgaactgaggacctactttgtctgcacagacactggcaagtttcagggg
ctggggctgaactga

KEGG   Pteropus alecto (black flying fox): 102885676
Entry
102885676         CDS       T02993                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase type 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale01100  Metabolic pathways
pale01522  Endocrine resistance
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04072  Phospholipase D signaling pathway
pale04114  Oocyte meiosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04713  Circadian entrainment
pale04714  Thermogenesis
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04727  GABAergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04913  Ovarian steroidogenesis
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04921  Oxytocin signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04961  Endocrine and other factor-regulated calcium reabsorption
pale04962  Vasopressin-regulated water reabsorption
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04976  Bile secretion
pale05032  Morphine addiction
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102885676 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102885676 (ADCY9)
   04371 Apelin signaling pathway
    102885676 (ADCY9)
   04020 Calcium signaling pathway
    102885676 (ADCY9)
   04072 Phospholipase D signaling pathway
    102885676 (ADCY9)
   04024 cAMP signaling pathway
    102885676 (ADCY9)
   04022 cGMP-PKG signaling pathway
    102885676 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102885676 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102885676 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102885676 (ADCY9)
   04062 Chemokine signaling pathway
    102885676 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    102885676 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    102885676 (ADCY9)
   04912 GnRH signaling pathway
    102885676 (ADCY9)
   04913 Ovarian steroidogenesis
    102885676 (ADCY9)
   04915 Estrogen signaling pathway
    102885676 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    102885676 (ADCY9)
   04921 Oxytocin signaling pathway
    102885676 (ADCY9)
   04926 Relaxin signaling pathway
    102885676 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    102885676 (ADCY9)
   04918 Thyroid hormone synthesis
    102885676 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    102885676 (ADCY9)
   04916 Melanogenesis
    102885676 (ADCY9)
   04925 Aldosterone synthesis and secretion
    102885676 (ADCY9)
   04927 Cortisol synthesis and secretion
    102885676 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102885676 (ADCY9)
   04270 Vascular smooth muscle contraction
    102885676 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    102885676 (ADCY9)
   04971 Gastric acid secretion
    102885676 (ADCY9)
   04972 Pancreatic secretion
    102885676 (ADCY9)
   04976 Bile secretion
    102885676 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102885676 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102885676 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    102885676 (ADCY9)
   04727 GABAergic synapse
    102885676 (ADCY9)
   04725 Cholinergic synapse
    102885676 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    102885676 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102885676 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    102885676 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    102885676 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102885676 (ADCY9)
   04714 Thermogenesis
    102885676 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885676 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    102885676 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102885676 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102885676 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102885676 (ADCY9)
   05163 Human cytomegalovirus infection
    102885676 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102885676 (ADCY9)
Enzymes [BR:pale01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102885676 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 DUF1053 zf-C2HC_2 AC_N
Other DBs
NCBI-GeneID: 102885676
NCBI-ProteinID: XP_006913938
LinkDB
Position
Unknown
AA seq 1353 aa
MASPPHQQLLQHHSTEVSCDSSGDSNSVRVKINPKQLSSISHPKHCKYSISSSCSSSGDS
GGVPRRVGAGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFGVHMRSKLIVMAVPALCFLVVCVGFFLFTFTKLYARHYVGTSLVLT
LLVFALTLAAQFQVLTPLSGRVDSSNHTLTAKPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLFLGVSYSVLFETFGYHFQGEDCFPSPETGPPHWELLSRALLHVCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEHFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGRVTERLGQSVVVDQLKGLKTYLIAGQRAKESHCSCSEALLSGFEVIDGSRVS
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFAPKSEGGTGGGAVQNGCQEEHKN
NTKASGGPNSKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELEQAYRTSYQEEVMKNSPVKTF
ASATFSSLLDVFLSTTVFLILSITCFLKYRAATTPPPPAALAVFGAALLLEVLSLVVSVR
MVFFLEDVMACTKHLLEWIAGWLPRHFIGAILVSLPALAVYSHVTSEFETNIHFTVFTGS
AILIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYISLCPDSSILESHLDAVQNFSSER
NPCNSSLPHDSRRPASLIGQEVILVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNATQCQDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDNGVVPQHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQNSDKTSLGSENNTQAKDCHLSSKRPWKEPVKAEE
RCRFGKAIEKSDCEEMGMEEANELTKLNVSKSV
NT seq 4062 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcagcaccacagcaccgaggtgagttgtgac
tccagcggagacagcaacagcgtgagggtcaaaatcaaccccaagcagctatcgtccatc
agccaccccaaacactgcaagtacagcatctcttccagctgtagcagctccggcgactca
ggcggggttccccggagagtgggcgctggaggccgcctgcgcaggcagaagaaactgccc
cagctgttcgagagggcctccagccggtggtgggaccccaaattcgactcggtgaacctg
gaggaggcttgccttgagcgctgcttcccgcagacccagcgccgcttccggtacgctctc
ttctacattggcttcgcctgcctgctctggagcatctattttggggtccacatgagatcc
aaactgattgtcatggcagtccctgctctgtgcttcctcgtggtgtgtgtgggctttttc
ctgtttaccttcaccaaactgtatgcccgacattacgtggggacctcgctggttctcacc
ctcctggtattcgccctgaccctggctgcccagtttcaggttctgacgcctctctcagga
cgtgttgacagctccaatcatactctcacagccaagcccacagacacttgcttatctcaa
gtggggagcttttccatgtgcatcgaagtgctctttttgctctacaccgtcatgcactta
cctttgtacttgagcttgtttttgggagtgtcttattctgttctttttgagacctttggc
tatcatttccaaggtgaagactgcttcccctcacctgaaacagggcctccgcactgggag
ctgttgagccgagccctgctccacgtctgtattcatgccattgggatccacctattcatc
atgtcccaggtgagatccaggagcacctttctcaaggtaggacagtccattatgcatgga
aaggatctggaagtggaaaaagccctgaaagaaaggatgattcattctgtgatgccaaga
atcatagctgatgacttgatgaaacagggggatgaggagagcgagaattctgtgaaaagg
cacgccacctccagccccaagaacaggaagaaaaaatcttccatacagaaagcccctata
gcattccgcccgtttaagatgcagcagattgaagaggtcagtattttatttgcagacatc
gtaggcttcactaagatgagtgccaacaagtctgctcatgccctggtgggtctcctcaat
gatctgttcggtcgcttcgaccggttgtgtgaagagaccaagtgtgagaaaatcagcacc
ctgggagactgctactactgcgtggcagggtgccctgagccccgggccgaccatgcctac
tgctgcatcgaaatgggcttgggcatgataagagccatcgagcacttctgccaggagaag
aaagagatggtgaacatgcgtgttggggttcacacagggactgtcttgtgcggcatcttg
ggcatgaggaggttcaaattcgatgtgtggtccaatgatgtgaacctggccaatctcatg
gagcagctgggagtggctggcaaggttcacatttctgaggccactgcaaaatacctagat
gatcggtacgaaatggaagatgggagagttactgaacgcctcggccagagcgttgttgtt
gaccagttgaaaggtttgaagacatacctgatagcgggtcagagagcgaaggagtctcat
tgcagctgttcagaggccttgctttcgggctttgaggtcattgacggctcacgggtgtcc
tcaggccctaggggacaggggacagcatcgccagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataatcttaagacctgcccttcgtgcggaatcacttttgctcccaaa
tcggaaggtggcacaggaggaggagcagtgcaaaacggctgtcaggaggagcataaaaat
aacaccaaggcttctggaggacctaattctaaaacgcaaaacggacttctgagcccaccc
caagaggagaagctcaccaatagccagacctccctgtgtgagattctacaggaaaaggga
aggtgggcaggtgtcagcttggaccagtctgctctccttccactgaggttcaagaacatc
cgggagaaaacagatgcccactttgtcgatgttatcaaagaagacagcctgatgaaagat
tatttttttaagccacccattaatcagttcagcttgaacttcttggatcaggagcttgag
caagcctacaggaccagttatcaagaagaggttatgaagaattcccctgtgaagactttt
gccagtgccaccttcagctccctcttggatgtgtttctgtcaacaacagtgtttctgatt
ctctccatcacctgcttcctgaagtacagggctgccaccacgcctcccccgcctgccgca
ctggcagtcttcggtgccgccctgctgctggaggtgctgtccctcgtggtgtctgtcagg
atggtatttttcctggaggatgtgatggcttgtaccaagcacctgctggagtggatagcc
ggctggctcccacgccacttcattggggccatcctggtgtctctccccgctctcgcggtt
tattcacatgtcacttcggaatttgagacaaacatacatttcacagtgttcacgggctca
gccatcctgatcgccgttgtgcactactgtaacttctgccagctcagctcctggatgcgg
tcctccttagctactgtcgtcggggctgggcccctccttctgctctacatctccctgtgc
ccggacagttctatactagagtcacaccttgatgcagtacagaatttcagttccgagagg
aatccctgcaatagttcattgccacatgacagcaggagaccagccagcctgattggccag
gaggtgattcttgtcttctttctcctactcttgttggtctggttcctgaatcgagaattc
gaagtcagctaccgccttcactaccacggggacgtggaggcggaccttcaccgcaccaaa
atccagagcatgagggaccaagccgactggctgctgaggaacatcatcccctaccatgtg
gctgaacagctgaaggtttctcagacctactccaagaaccatgacagcgggggagtcatc
tttgccagcattgtcaacttcagcgagttctacgaggaaaactacgaggggggcaaggag
tgctaccgggtcctcaacgagctgatcggggacttcgatgagctcctgagcaagccagac
tacagcagcattgagaagatcaagaccatcggggccacgtacatggccgcatcagggctg
aacgccacacagtgccaggacggcagccacccgcaggagcacctgcagatcttgtttgag
tttgccaaggagatgatgcgcgtggtggacgatttcaacaacaacatgttgtggttcaac
ttcaagctcagagtcggcttcaaccatgggcccctgacagcaggggtcatcggaaccacc
aagctactatatgacatctggggagacaccgtcaacatcgccagcaggatggacaccacg
ggggtggagtgccgcatccaggtgagtgaagagagctaccgcgtcctcagcaagatgggc
tacgactttgactacaggggcacggtgaacgtcaaaggcaaaggtcagatgaagacctac
ctttacccaaagtgcacggacaatggggtcgtgccgcagcaccagctgtccatctcccca
gacatccgagtccaggtggacggcagcatcggacggtctcccacggacgagattgccaac
ctggtgccttccgtacagaactcggacaagacgtctctgggttctgagaataacacgcaa
gccaaggactgtcacctgtcttcaaagagaccctggaaagagcctgtcaaagccgaagaa
aggtgtcgatttggcaaagccatagagaaaagcgactgtgaagaaatggggatggaagaa
gccaatgaactcaccaagctcaatgtctcaaagagtgtgtga

KEGG   Pteropus alecto (black flying fox): 102886232
Entry
102886232         CDS       T02993                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale01100  Metabolic pathways
pale01522  Endocrine resistance
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04072  Phospholipase D signaling pathway
pale04114  Oocyte meiosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04713  Circadian entrainment
pale04714  Thermogenesis
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04727  GABAergic synapse
pale04740  Olfactory transduction
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04913  Ovarian steroidogenesis
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04921  Oxytocin signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04962  Vasopressin-regulated water reabsorption
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04976  Bile secretion
pale05032  Morphine addiction
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102886232 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102886232 (ADCY3)
   04371 Apelin signaling pathway
    102886232 (ADCY3)
   04020 Calcium signaling pathway
    102886232 (ADCY3)
   04072 Phospholipase D signaling pathway
    102886232 (ADCY3)
   04024 cAMP signaling pathway
    102886232 (ADCY3)
   04022 cGMP-PKG signaling pathway
    102886232 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102886232 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102886232 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102886232 (ADCY3)
   04062 Chemokine signaling pathway
    102886232 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    102886232 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    102886232 (ADCY3)
   04912 GnRH signaling pathway
    102886232 (ADCY3)
   04913 Ovarian steroidogenesis
    102886232 (ADCY3)
   04915 Estrogen signaling pathway
    102886232 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102886232 (ADCY3)
   04921 Oxytocin signaling pathway
    102886232 (ADCY3)
   04926 Relaxin signaling pathway
    102886232 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    102886232 (ADCY3)
   04918 Thyroid hormone synthesis
    102886232 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    102886232 (ADCY3)
   04916 Melanogenesis
    102886232 (ADCY3)
   04925 Aldosterone synthesis and secretion
    102886232 (ADCY3)
   04927 Cortisol synthesis and secretion
    102886232 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102886232 (ADCY3)
   04270 Vascular smooth muscle contraction
    102886232 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    102886232 (ADCY3)
   04971 Gastric acid secretion
    102886232 (ADCY3)
   04972 Pancreatic secretion
    102886232 (ADCY3)
   04976 Bile secretion
    102886232 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102886232 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102886232 (ADCY3)
   04727 GABAergic synapse
    102886232 (ADCY3)
   04725 Cholinergic synapse
    102886232 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    102886232 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    102886232 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    102886232 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    102886232 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    102886232 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102886232 (ADCY3)
   04714 Thermogenesis
    102886232 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102886232 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    102886232 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102886232 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102886232 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102886232 (ADCY3)
   05163 Human cytomegalovirus infection
    102886232 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102886232 (ADCY3)
Enzymes [BR:pale01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102886232 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 102886232
NCBI-ProteinID: XP_006910341
LinkDB
Position
Unknown
AA seq 1145 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPERGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSRDQLAPLVVAGIWLLLDII
LFVLCKKGLLPDRVTRKVVPYLLWLLITAQIFSYLGLNFARAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVVISVVSCIVHTLVLGVTVAQQQQDGLKGMQLLREILASVSLYLCAIIVG
ITSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTLDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKKTAVQNGLNGSALPNGAPPSSQPSSPALIETKEPNGSVHA
SGSTSEEPEEQGAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMEPEMETRYSVEKEKQSGAAFSCSCVVLLCAALGEMLVDPWLMTN
YVTFVVGEVLLLILTICSLAAIFPQAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPSNGTAGMEMEDGCTENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLITGAVAVVNIYAWCPIFDEYDRRRFQEHNFPVVALEKMQILSTAGLNGTDRLPLLPSK
YSMTAMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEDTQAILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPATFPNGSSVTLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgaccccgagtactcggcggagtactcggcggagtac
tccgtcagcctgccctctgaccctgagcgcggggtgggccggacccatgaaatctctgtg
cggaactcggggtcctgcctctgcctgcctcgctttatgcggctgactttcgtgcccgag
tccttggagaacctgtaccagacctatttcaaaaggcagcgccatgagaccctgctggtg
ctggtggtcttcgcagccctcttcgactgctacgtggtggtcatgtgcgctgtggtcttc
tcccgcgaccagctggctcccctcgtggtggctgggatctggctgctgttggatatcatc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggtcacccggaaagtggtgccc
tatctcctgtggctgctgataacagcccagatcttctcctacttgggcctgaactttgcc
cgcgcccatgcggccagcgacacagtgggctggcaggccttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgttgtcatctctgtggtctcctgtattgtg
cacaccctcgtcttgggggtcaccgtggcccagcagcagcaggatggactgaaggggatg
cagttgctgagagagatcctggccagtgtctccctgtacctttgcgccatcatcgtgggc
atcacgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcacgtggccgacgagatgctcaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatc
cttttcgcggacatcgtgggcttcacccagctgtcctctgcctgcagcgcacaggagctc
gtgaagctgctcaacgagctctttgcccgttttgacaagctggcggccaaataccaccag
ctgcggattaagatcctgggcgactgttactattgcatctgtggcctgcctgactaccga
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgagagaagacgaagaccggggtggacatgcgtgtgggggtgcacacaggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgatgtttggtccactgatgtgact
gtggccaacaagatggaggccggcggcatccccgggcgtgtgcacatctcacagagcacc
ttggactgcctgaagggggagttcgacgtggagccgggcgacgggggcagccgctgcgac
tacctggatgagaagggcatcgaaacctacctcatcatcgcatccaagccagaggtgaag
aagacggccgtccaaaatggcctcaatggctcggccctgcccaatggagccccgccttcc
tcgcagcccagctcccccgccctcatcgagaccaaggagcccaacgggagtgtccacgcc
agcgggtccacgtcggaggagcccgaggagcaaggggcccaggctgacaacccctccttc
cccaaccctcgccggaggctgcgcctccaggacctggccgacagagtggtagacgcctcc
gaggacgagcatgagctcaaccagctgctcaacgaggccctgctcgagcgggagtccgcc
caggtagtgaagaagagaaacaccttcctcctgtccatgcggttcatggagcccgagatg
gagacgcgctactcagtggagaaggagaagcagagcggagctgccttcagctgctcctgc
gtcgtcctgctctgtgcggccctgggcgagatgctcgtcgacccctggctaatgacaaac
tatgtgacctttgtggttggggaggttctgcttctgatcctgacgatctgctcgctggct
gccatctttccccaggcctttcctaagaagctcgtggccttctcaacctggatcgaccgg
acccgctgggccaggaacacctgggccatgttagccatcttcattctggttatggcaaat
gtcgtggacatgcttagctgcctccagtactacacgggacccagcaacggcaccgcaggg
atggagatggaggatggctgcacggagaaccccaagtattacaactatgtcgccgtgctg
tcactcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatg
ctgctcatcactggcgccgtagccgtcgtcaacatctatgcctggtgccccatcttcgat
gaatatgaccgcagacgtttccaggaacacaactttcctgtggttgccttggagaagatg
cagatactctccaccgctgggctcaatggcactgacaggctgcccctgctgccctccaag
tactcgatgacagcgatgatcttcgtcatgatgctgagcttttactacttctcccgccac
gtggaaaaactggctcggacactgttcttatggaagattgaggtccatgaccagaaggaa
cgtgtctatgagatgcgacgctggaatgaggccttggtcaccaacatgttgcccgagcac
gtggcacgccatttcctggggtccaagaagagagatgaggaactgtacagccagtcttat
gatgagattggagtcatgtttgcctccctgcccaacttcgctgacttctacacagaggag
agcatcaataatggtggcattgagtgtctgcgctttctcaacgagatcatctcagatttt
gactctctcctggacaatcccaaattccgggtcatcaccaagatcaaaaccattggcagt
acctatatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagctcc
aacaaggaggagaagtcagacaaggagcgctggcagcacctggctgatctggctgacttc
gcactagccatgaaggatacgcttaccaacatcaacaaccagtccttcaacaacttcatg
ctgcgcataggcatgaacaaaggaggggtactggctggggtcattggagcccggaaacca
cactatgacatctggggcaacacagtcaacgttgccagcaggatggagtccacgggggtc
atgggcaacattcaggtggtagaagacacacaggccatcctccgagagtacggcttccgc
ttcgtgaggcgagggcccatctttgtgaaagggaaaggggagctgctaacctttttcttg
aaaggccgtgacaagccagccaccttccctaacggctcctctgtcacactgccccaccag
gtggtagacaactcctga

KEGG   Pteropus alecto (black flying fox): 102887497
Entry
102887497         CDS       T02993                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase type 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale01100  Metabolic pathways
pale01522  Endocrine resistance
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04072  Phospholipase D signaling pathway
pale04114  Oocyte meiosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04713  Circadian entrainment
pale04714  Thermogenesis
pale04720  Long-term potentiation
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04727  GABAergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04913  Ovarian steroidogenesis
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04921  Oxytocin signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04976  Bile secretion
pale05032  Morphine addiction
pale05142  Chagas disease
pale05146  Amoebiasis
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102887497 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102887497 (ADCY1)
   04371 Apelin signaling pathway
    102887497 (ADCY1)
   04020 Calcium signaling pathway
    102887497 (ADCY1)
   04072 Phospholipase D signaling pathway
    102887497 (ADCY1)
   04024 cAMP signaling pathway
    102887497 (ADCY1)
   04022 cGMP-PKG signaling pathway
    102887497 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102887497 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102887497 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102887497 (ADCY1)
   04062 Chemokine signaling pathway
    102887497 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    102887497 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    102887497 (ADCY1)
   04912 GnRH signaling pathway
    102887497 (ADCY1)
   04913 Ovarian steroidogenesis
    102887497 (ADCY1)
   04915 Estrogen signaling pathway
    102887497 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    102887497 (ADCY1)
   04921 Oxytocin signaling pathway
    102887497 (ADCY1)
   04926 Relaxin signaling pathway
    102887497 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    102887497 (ADCY1)
   04918 Thyroid hormone synthesis
    102887497 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    102887497 (ADCY1)
   04916 Melanogenesis
    102887497 (ADCY1)
   04925 Aldosterone synthesis and secretion
    102887497 (ADCY1)
   04927 Cortisol synthesis and secretion
    102887497 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102887497 (ADCY1)
   04270 Vascular smooth muscle contraction
    102887497 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    102887497 (ADCY1)
   04971 Gastric acid secretion
    102887497 (ADCY1)
   04972 Pancreatic secretion
    102887497 (ADCY1)
   04976 Bile secretion
    102887497 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102887497 (ADCY1)
   04727 GABAergic synapse
    102887497 (ADCY1)
   04725 Cholinergic synapse
    102887497 (ADCY1)
   04720 Long-term potentiation
    102887497 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    102887497 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102887497 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    102887497 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    102887497 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102887497 (ADCY1)
   04714 Thermogenesis
    102887497 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102887497 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    102887497 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102887497 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102887497 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102887497 (ADCY1)
   05163 Human cytomegalovirus infection
    102887497 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102887497 (ADCY1)
   05142 Chagas disease
    102887497 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102887497 (ADCY1)
Enzymes [BR:pale01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102887497 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 102887497
NCBI-ProteinID: XP_024902251
LinkDB
Position
Unknown
AA seq 899 aa
MYGVFVRVLAERSQRRAFLQARNCIEDRAVTPPVSPLQERLLMSLLPRNVAMEMKEDFLK
PPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCR
RIKILGDCYYCVSGLTQPKADHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVL
CGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLTCLNGDYEVEPGHGHERNSF
LRTHNIETFFIVPSHRRKIFPGLILSDIKPAKRMRFRTVCYLLVQLMHCRRVFKAEVPFS
NVMTCEDDDKRRALRTASEKLRNRSSFSTNAAHAAPGTRVNRYIGRLLEARQTELEMADL
HFFTLKYKQAEREHKYHQLRDEHFSSAVVLALVLAALFGLVYLLIIPQSLPVLLLLVFCI
CFLVACVLYLHITRVQCFPGCLTIRIRTVLCIFIVVLIYAVAQGCVVGCLPWAWSASANG
SLVVLSPGGRXXXXXXXXXXXXXHALLCGLVGTLPLTVFLRVSSLPKVILLSVLATSYIL
VLELSGYTRAAGGGPVSGGSFEPVVAILLFSCTLALHARQVDIKLRLDYLWAAQAEEERD
DMEQVKLDNKRILFNLLPAHVAQHFLTSNPRSMDLYYQSYSQVGVMFASIPNFNDFYIEL
DGNNMGVECLRLLNEIIADFDELMEKDFYKDLEKIKTIGSTYMAAVGLVPTTGAKARKCI
SAHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVN
VASRMDSTGVPGRIQVTEEVHRLLRRRAYRFSCRGKVSVKGKGEMLTYFLEGRTDGNGPQ
TRPLSSERRTCLYGRAGLQTGLATGCPRVGAGPGALQGSGLAPQPPGPHLPPAAAGKEA
NT seq 2700 nt   +upstreamnt  +downstreamnt
atgtacggcgtcttcgtgagggtcctggccgagcgctcccagcggagagcctttctgcag
gcccggaactgcatcgaggaccgggctgtcacaccgcccgtctctcccctccaggagcgg
ctgctcatgagtctcctgccccggaatgtcgccatggagatgaaggaagacttcctgaag
cccccagagaggattttccacaagatttacatccagcggcatgacaacgtgagcatcctc
ttcgcggacatcgtgggcttcacgggcctggcgtcgcagtgcacggcacaggagctggtg
aagctgctcaacgagctcttcggcaagtttgacgagctggccacggagaaccactgccgc
cgcatcaagatcctgggggactgctactactgcgtgtccggcctcacgcagcccaaggcc
gaccacgcccactgctgcgtggagatgggcctggacatgatcgacaccatcacgtccgtg
gccgaggccaccgaggtggacctgaacatgcgcgtggggctgcacaccggccgcgtcctc
tgcggtgtcctgggcctgcgcaagtggcagtatgacgtgtggtccaacgacgtgactctg
gccaacgtcatggaggccgccggcctgcccgggaaggttcacatcacaaagacgacgctg
acctgcctgaacggtgactacgaggtggagccgggccacgggcacgagaggaacagtttc
ctgaggacacacaacatcgagaccttcttcattgtgccctcgcatcggcggaagatattt
ccagggctgatcctgtcggacatcaagccggccaagcggatgaggtttcggacggtgtgc
tacctgctggtgcagctcatgcactgccggcgggtgttcaaggccgaggtccccttctcc
aacgtcatgacctgcgaggacgacgacaagcgcagggcgttgagaacggcctcagaaaag
ctcaggaaccgctcgtccttctccacgaacgccgcgcacgccgccccgggcacccgcgtc
aacaggtacatcggccgcctcctggaagcccgccagacggagctggagatggcagacctg
cacttcttcaccctgaagtacaagcaggccgagcgggagcacaagtaccaccagctccgg
gacgagcacttcagcagcgccgtggtgctcgccctcgtcctggccgccttgttcggcctc
gtctacctcctgatcatcccgcagagtctgcctgtcctgctcctgctggtgttctgcatc
tgcttcttggtggcttgtgtcctctacctgcacatcacccgggtccagtgcttcccgggc
tgcctgaccatccgcatccgcaccgtgctgtgcattttcatcgtggtcctgatctatgcc
gtggcccagggatgcgtggtgggctgcctgccctgggcctggagcgccagtgccaacggg
tccctggtggtcctgtcgcccggcggccgcgannnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnncgcacgccctgctctgcggcctggtgggcacgctcccgctcaccgtgttcctg
cgcgtctcctccttgccgaaggtcatcctgctgtccgtgctcgccacgtcctacatcctg
gtcctggagctcagcggctacaccagggccgcggggggcggcccggtctctgggggcagc
ttcgagccggtcgtggccatcctgctgttctcgtgcacgctggccctgcacgcccggcag
gtggacatcaagctgcggctggactacctgtgggctgcgcaggctgaggaggagcgtgac
gacatggagcaggtgaagctggacaacaagaggattctgttcaacctgctgccggcccac
gtggcccagcactttctcacgtccaatccccggagcatggacctgtactaccagtcgtac
tcgcaggtgggcgtcatgttcgcctccatccccaacttcaacgacttctacatcgagctg
gacggcaacaacatgggggtggagtgcctgcgcctcctcaacgagatcatcgctgacttc
gacgagctcatggagaaggacttctacaaggacctggagaagatcaagaccatcgggagc
acctacatggccgccgtggggctggtgcccacgactggggccaaggctaggaagtgcatc
tctgcccacctcagcacgctggcggactttgccatcgagatgtttgacgtcctggacgag
atcaactaccagtcgtacaatgactttgtgctccgcgtgggcatcaacgtgggccccgtg
gtggccggagtgatcggggctcgccggccacagtacgacatctggggaaacacggtcaac
gtggccagtcggatggacagcaccggggttccaggcagaatccaggtgacggaggaggtg
caccggctgctgaggcggcgcgcctaccgcttctcgtgccgcggcaaggtcagcgtcaag
ggcaagggcgagatgctgacctacttcttggaaggcaggaccgatgggaatggcccccag
accaggcccctgagctcggagcggagaacgtgcctgtatgggagagccggcctccagacc
ggactggccacaggctgcccccgggtcggagccgggccgggggctctgcagggctcgggg
ctcgccccgcagccccccggcccacacctgcctccagcagctgccgggaaggaggcttag

KEGG   Pteropus alecto (black flying fox): 102890575
Entry
102890575         CDS       T02993                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale01100  Metabolic pathways
pale01522  Endocrine resistance
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04072  Phospholipase D signaling pathway
pale04114  Oocyte meiosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04713  Circadian entrainment
pale04714  Thermogenesis
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04727  GABAergic synapse
pale04742  Taste transduction
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04913  Ovarian steroidogenesis
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04921  Oxytocin signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04976  Bile secretion
pale05032  Morphine addiction
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102890575 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102890575 (ADCY4)
   04371 Apelin signaling pathway
    102890575 (ADCY4)
   04020 Calcium signaling pathway
    102890575 (ADCY4)
   04072 Phospholipase D signaling pathway
    102890575 (ADCY4)
   04024 cAMP signaling pathway
    102890575 (ADCY4)
   04022 cGMP-PKG signaling pathway
    102890575 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102890575 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102890575 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102890575 (ADCY4)
   04062 Chemokine signaling pathway
    102890575 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    102890575 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    102890575 (ADCY4)
   04912 GnRH signaling pathway
    102890575 (ADCY4)
   04913 Ovarian steroidogenesis
    102890575 (ADCY4)
   04915 Estrogen signaling pathway
    102890575 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    102890575 (ADCY4)
   04921 Oxytocin signaling pathway
    102890575 (ADCY4)
   04926 Relaxin signaling pathway
    102890575 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    102890575 (ADCY4)
   04918 Thyroid hormone synthesis
    102890575 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    102890575 (ADCY4)
   04916 Melanogenesis
    102890575 (ADCY4)
   04925 Aldosterone synthesis and secretion
    102890575 (ADCY4)
   04927 Cortisol synthesis and secretion
    102890575 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102890575 (ADCY4)
   04270 Vascular smooth muscle contraction
    102890575 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    102890575 (ADCY4)
   04971 Gastric acid secretion
    102890575 (ADCY4)
   04972 Pancreatic secretion
    102890575 (ADCY4)
   04976 Bile secretion
    102890575 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102890575 (ADCY4)
   04727 GABAergic synapse
    102890575 (ADCY4)
   04725 Cholinergic synapse
    102890575 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    102890575 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    102890575 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    102890575 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    102890575 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    102890575 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102890575 (ADCY4)
   04714 Thermogenesis
    102890575 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102890575 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    102890575 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102890575 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102890575 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102890575 (ADCY4)
   05163 Human cytomegalovirus infection
    102890575 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102890575 (ADCY4)
Enzymes [BR:pale01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102890575 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 102890575
NCBI-ProteinID: XP_006913595
LinkDB
Position
Unknown
AA seq 1077 aa
MPRLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLSALLALLAVAWASGRELASDRG
FLATVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWAALLALGHGFLFTGGVVSAWDQV
SFFIFVIFTTYAMLPLGMRDAAALGLTSSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLGG
AYAVEDVAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLPEKALASFSPQWSLDRSRTPRRLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFRYYAACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLLLFACFSEHLTRCVLKGPKMLHWLPALSGLVATRP
GLRVALGTATILLVFSMAITSLFFLPAASNCPFRVPNVSSEAFNLSWELPGSLPLISIPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLVASCSLFLHSHAWLSDCLVARLYLGPLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETEMMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTICSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETARALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRVGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atgccccgcctcttcagtccccggccaccgcccagcgaagacctcttctatgagacctac
tacagtttgagccagcagtacccactgctgctactgctcctggtgatcgtgctctccgca
ctcctggcgttgcttgctgtcgcctgggccagtggcagggagctggcttcggacaggggc
ttcctggccacagtgctgtgcgcgctgggcgggttctcattgctgctgggcctggcttcc
cgcgagcagcgactgcagcgctggacgcgtcccctctccggccttgtgtgggcagcgtta
ctcgcgctaggccacggcttcctgttcactggaggcgtagtgagcgcctgggaccaggtg
tcctttttcatctttgtcatcttcaccacgtatgccatgctgcccttgggcatgcgggac
gccgccgccttgggcctcacttcatcactctcacacctgctggttctcgggctgtatctt
gggcctcagccagactcacgaccggcgctgctgcctcagttggcagcaaacgcggtgctg
ttcctgtgcgggaacgtggccggggcgtatcacaaagcgctgatggagcgggcgctgcgg
gccaccttcagagaggcgcttagttccctgcactctcgccggaggctggacacggagaag
aagcatcaggaacaccttctcttgtccatccttcctgcctacttggcccgagagatgaag
gcggagatcatggcaaggctgcaggctggacaggggtcacggccagagagcaccaacaac
ttccacagcctttatgtaaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacacggctggccagtgaatgctccccaaaggagctggtgctcatgctcaacgag
ctctttggcaagttcgaccagattgccaaggagcatgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctctgggctgccgctctcactaccagaccacgccatcaac
tgtgtgcgcatggggctggacatgtgccgggccatcaggaaattgcgggcagccaccggt
gttgacatcaatatgcgcgtgggcgtgcactcgggcagcgtgctctgcggagtcatcggg
ctgcagaaatggcagtatgatgtctggtcccatgatgtcacactggccaaccacatggag
gcaggtggcgtgccaggacgagtgcatatcacaggggctaccctggccctgctaggagga
gcttacgctgtggaggatgtagccatggaacaccgggacccataccttcgagagctaggg
gagcctacctacctggtcatcgatccccgggccgaggaggaggatgagaagggcactgca
ggagggttgctgtcctctctcgaaggtcccaagatgcgtccatcactgctgatgacccgc
tatctggaatcctggggtgcagccaagccttttgcccatctgagccacgtagagagccct
gtgtccacctccacccctctgccggagaaagccctggcttccttcagcccccagtggagc
ctggaccggagccgtacccctcggagactagatgatgaactggacactggggatgccaag
ttcttccaggtcatcgaacagctcaactctcagaaacagtggaagcagtcaaaggacttc
aacccactgacattgtacttccgagagaaggagatggaaaaagagtatcgactctccgca
ctccctgccttcagatactatgcagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctggtgacaaacaggcccccggctctggccatcacctatagcatcaccttc
ctcctcttcctcctcctcctcttcgcctgcttctcagagcacctgacgaggtgtgttttg
aaaggccccaagatgctgcactggcttcccgcactgtctggcctggtggccacacgtccc
ggactgcgggttgccctgggcactgccaccatcctccttgtcttttccatggccattacc
agcctgttcttcttaccggcagcatcgaactgccctttccgggtgcccaatgtgtcctct
gaggctttcaacctctcctgggagctccctgggtccttgcctctcatcagcatcccatac
tccatgcactgctgtgtgctgggtttcctctcctgctccctctttctgcacatgagcttt
gaactgaagctgctgctgctcctgctgtggctggtggcctcctgctccctcttcctgcac
tcccatgcctggctgtcggattgcctcgttgcccgcctctatctcggccccttggactcc
aggccaggggtgctgaaggagcccaaactcatgggagctatctccttcttcatcttcttc
ttcacactccttgtcttggctcggcagaatgagtattattgccgcctggacttcctgtgg
aagaagaagctgaggcaggagcgggaagagacagagatgatggagaacctgactcggctg
ctcttggagaacgtgcttcctgcgcacgtggccccccagttcattggccagaaccggcgc
aacgaggacctctaccaccagtcctacgagtgtgtctgtgtcctcttcgcctcagtccca
gactttaaggagttttactccgaatctaacatcaaccatgaggggctagagtgtctgcgg
ctgctcaatgagatcattgctgattttgatgagctgctctctaagcccaagttcagtggg
gtggaaaagatcaaaacgatctgcagcacctacatggcagctacaggcttaaatgccacc
tctggacaggatgcacagcaggatgctgagcgaagctgcagccaccttggcaccatggtg
gagtttgcggtggcccttgggtctaagctggatgtcatcaacaagcactcattcaacaac
ttccgcctgcgtgtggggttgaaccatggacctgtggtggctggagtgataggggcccag
aagccacaatatgacatctggggcaacacagtgaatgtggccagccgcatggagagtaca
ggagtcctgggcaagatccaagtgactgaggagacagcccgtgccctgcagtccttaggt
tatacctgctacagccggggtgtcatcaaggtcaaaggcaaagggcagctgtgcacctac
ttcctgaacacagatttgacacgagttggacctccttcagccaccctgggctga

KEGG   Pteropus alecto (black flying fox): 102890588
Entry
102890588         CDS       T02993                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6 isoform X2
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale01100  Metabolic pathways
pale01522  Endocrine resistance
pale04015  Rap1 signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04072  Phospholipase D signaling pathway
pale04114  Oocyte meiosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04713  Circadian entrainment
pale04714  Thermogenesis
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04727  GABAergic synapse
pale04742  Taste transduction
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04913  Ovarian steroidogenesis
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04921  Oxytocin signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04924  Renin secretion
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04961  Endocrine and other factor-regulated calcium reabsorption
pale04962  Vasopressin-regulated water reabsorption
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04976  Bile secretion
pale05032  Morphine addiction
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102890588 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102890588 (ADCY6)
   04371 Apelin signaling pathway
    102890588 (ADCY6)
   04072 Phospholipase D signaling pathway
    102890588 (ADCY6)
   04024 cAMP signaling pathway
    102890588 (ADCY6)
   04022 cGMP-PKG signaling pathway
    102890588 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102890588 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102890588 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102890588 (ADCY6)
   04062 Chemokine signaling pathway
    102890588 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    102890588 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    102890588 (ADCY6)
   04912 GnRH signaling pathway
    102890588 (ADCY6)
   04913 Ovarian steroidogenesis
    102890588 (ADCY6)
   04915 Estrogen signaling pathway
    102890588 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    102890588 (ADCY6)
   04921 Oxytocin signaling pathway
    102890588 (ADCY6)
   04926 Relaxin signaling pathway
    102890588 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    102890588 (ADCY6)
   04918 Thyroid hormone synthesis
    102890588 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    102890588 (ADCY6)
   04916 Melanogenesis
    102890588 (ADCY6)
   04924 Renin secretion
    102890588 (ADCY6)
   04925 Aldosterone synthesis and secretion
    102890588 (ADCY6)
   04927 Cortisol synthesis and secretion
    102890588 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102890588 (ADCY6)
   04270 Vascular smooth muscle contraction
    102890588 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    102890588 (ADCY6)
   04971 Gastric acid secretion
    102890588 (ADCY6)
   04972 Pancreatic secretion
    102890588 (ADCY6)
   04976 Bile secretion
    102890588 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102890588 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102890588 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    102890588 (ADCY6)
   04727 GABAergic synapse
    102890588 (ADCY6)
   04725 Cholinergic synapse
    102890588 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    102890588 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    102890588 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    102890588 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    102890588 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    102890588 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102890588 (ADCY6)
   04714 Thermogenesis
    102890588 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102890588 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    102890588 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102890588 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102890588 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102890588 (ADCY6)
   05163 Human cytomegalovirus infection
    102890588 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102890588 (ADCY6)
Enzymes [BR:pale01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102890588 (ADCY6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD Shisa
Other DBs
NCBI-GeneID: 102890588
NCBI-ProteinID: XP_015448692
LinkDB
Position
Unknown
AA seq 1165 aa
MSWFSGLLVPKVDERKTAWGECNGQKRPRHGTRTSGFCAPRYMSCLQDAQPPSPTPATPP
RCPWQEEAFIRRGGPGKGTELGLRAVALGFEDTETTALGAADVAPNVAPRSSRSCWRRLV
QVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLTFHAAPAHPQPAYVAL
LACAAVLFVVLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAANPHSPSVGLWCPV
FFVYITYTLLPIRMRAAVFSGLGLSTLHLILAWQLNRGDAFLWKQLGANMLLFLCTNVIG
ICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKE
DMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRI
KILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCG
VLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLK
EQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRSKDSKAFRQMG
IDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSR
KVDPRFGAYVACALLVFCFICFIQLLVFPHSTLMLGIYTGIFLLLLITMLTCAVYSCGSL
FPKGLQHLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTSIRTCAARMLNLTPAD
ITVCHLQQLNYSLGLDAPLCEGTVPTCSFPEYFVGNMLLSLLASSVFLHISSIGKLAMIF
VLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVILL
VFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLAR
ERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEER
FRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQM
KIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQL
ECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3498 nt   +upstreamnt  +downstreamnt
atgtcatggttcagtggcctcctggtacccaaagtggatgaacggaaaacagcctggggg
gaatgcaatgggcagaagcgcccgcgtcatgggactcggaccagtggcttctgcgcaccc
cgctatatgagctgcctccaggatgcacagccacccagccccacccctgcaaccccacct
cggtgcccctggcaggaggaggccttcatccggaggggtggccctggcaagggcacagag
ctggggctgcgggccgtggccctgggctttgaggacactgagacgacagcactcggggca
gctgacgtggcacccaatgtggcacccaggagcagtcgatcctgttggcgccgtctggtt
caggtgttccagtcgaagcagttccgctcagccaagctagagcgcctgtaccagcggtac
ttcttccagatgaaccagagtagcttgacgctgctgatggcagtgcttgtgctgctcacg
gctgtgctgctgaccttccatgccgcgcctgcccaccctcagcctgcctatgtggccctg
ctggcctgtgcggctgtcctctttgtggtgctcatggtggtgtgtaaccgacacagcttt
cgccaggactccatgtgggtggtgagctatgtggtgctgggcatcctggcagctgtgcag
gttgggggtgccctggcagccaacccccacagcccctccgtaggcctttggtgccctgtg
ttctttgtctacatcacctacactctcctacccatccgcatgcgggcagctgtcttcagt
ggcctgggcctctccaccctgcatttgatcttggcctggcaactcaaccgtggtgatgcc
ttcctctggaagcagctcggtgccaacatgctgctattcctctgcacgaatgtcattggc
atctgcacacactacccagctgaggtgtctcagcgccaggcctttcaggagacccgcggg
tacatccaggcccggctgcacctgcagcatgagaatcggcagcaggaacgcctgctgctg
tcagtgttgccccagcacgttgccatggagatgaaagaagacatcaacacaaagaaggaa
gacatgatgttccacaagatctacatccagaagcatgacaatgtcagcatcctgtttgca
gacattgaaggtttcaccagcctggcatcacagtgcactgcacaggagctggttatgacc
ctgaatgagctctttgcccggtttgacaagcttgctgcagaaaatcactgcctgaggatc
aagatcttaggggactgttactactgtgtgtcagggttgccggaggcccgggcagaccat
gcccactgctgtgtggagatgggggtggacatgattgaggccatctcgctggtgcgtgag
gtgacaggtgtgaacgtgaacatgcgcgtgggcatccacagtggacgtgtgcactgcggt
gtccttggtctgcggaagtggcaattcgatgtgtggtccaatgacgtgactctggccaac
cacatggaggcagggggccgggctggccgcatccacattactcgggccacgctgcagtac
ctgaacggggactacgaggtggagccagggcgtggcggtgagcgtaacgcgtacctcaag
gagcagcacattgagaccttcctgatccttggtgccagccagaaacggaaagaggagaaa
gccatgctggccaagctgcagcgaacgcgggccaactccatggaagggctgatgccacgc
tgggtgcctgaccgggccttctcccggagcaaagactccaaggcattccgccagatgggc
attgatgattccagcaaagacaaccggggtgcccaagatgccctgaaccctgaggatgaa
gtagacgagttcctgggccgtgccatcgatgcccgcagcattgatcagctgcgcaaggac
catgtgcgccggttcctactcacctttcagagagaggatcttgaaaagaagtactcaagg
aaggtggatccccgcttcggagcctacgtggcctgtgccctgttggtcttctgcttcatc
tgcttcatccagctcctcgtcttcccacactcaacactgatgcttggaatctataccggg
atctttctgctgctgttgatcaccatgctgacctgtgccgtgtactcctgtggctccctg
ttccctaagggcctgcaacatctatcacgtagcattgtgcgctctcgggcacacagcacc
gctgttggcatcttttcagtcctgcttgtgttcacctccgccattgctaacatgttcacc
tgtaaccacacctccatacggacctgcgcagccaggatgctgaatttaacacctgctgac
atcactgtctgccacctgcagcagctcaattactctctgggcctggatgctcccctgtgt
gagggcaccgtacccacctgcagcttccccgagtacttcgtcgggaacatgctgctgagt
ctgttggccagctctgtcttcctgcacatcagtagcatcggaaagttggccatgatcttt
gttttggggctcatctatttggtgctgcttctcctgggccccccagccaccatctttgac
aactatgacctactgcttggtgtccatggcttggcttcttctaatgagacttttgatggg
ctggactgcccagctgcagggagggtggcactcaaatatatgacccccgtgattctgctg
gtgtttgccctggccctgtatctgcatgctcagcaggtggaatcgactgcccgcctggac
ttcctctggaaactgcaggcaacaggggagaaggaggagatggaggagctccaggcatac
aaccggcggctgttgcataacattctgcccaaggatgtagctgcccacttcctggcccgg
gagcgccggaacgacgagctctactatcagtcgtgtgagtgtgtggctgtcatgtttgcc
tccattgccaacttctctgagttctacgtggagctggaggcaaataatgagggtgtggag
tgcctgcggctgctcaacgagattatcgctgattttgatgagatcatcagtgaggagcgg
ttccggcagctggagaagatcaagacgattggtagcacctacatggctgcctctgggctg
aacgccagcacctatgatcaggtgggccgctcccacatcaccgcccttgccgactatgcc
atgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaatttccagatg
aagatcggactgaacatgggcccagttgtggcaggtgtcattggggctcggaagccacag
tatgacatctgggggaacacagtgaatgtctctagccgtatggacagcacaggggtccct
gacagaatccaggtgaccactgacctgtaccaggttctggctgccaagggctaccagctg
gagtgtcgaggagtggtcaaagtgaagggcaagggggagatgaccacctacttcctcaat
gggggccccagcagttag

KEGG   Pteropus alecto (black flying fox): 102893265
Entry
102893265         CDS       T02993                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase type 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale01100  Metabolic pathways
pale01522  Endocrine resistance
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04072  Phospholipase D signaling pathway
pale04114  Oocyte meiosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04713  Circadian entrainment
pale04714  Thermogenesis
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04727  GABAergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04913  Ovarian steroidogenesis
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04921  Oxytocin signaling pathway
pale04922  Glucagon signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04976  Bile secretion
pale05032  Morphine addiction
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102893265 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102893265 (ADCY2)
   04371 Apelin signaling pathway
    102893265 (ADCY2)
   04020 Calcium signaling pathway
    102893265 (ADCY2)
   04072 Phospholipase D signaling pathway
    102893265 (ADCY2)
   04024 cAMP signaling pathway
    102893265 (ADCY2)
   04022 cGMP-PKG signaling pathway
    102893265 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102893265 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102893265 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102893265 (ADCY2)
   04062 Chemokine signaling pathway
    102893265 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    102893265 (ADCY2)
   04922 Glucagon signaling pathway
    102893265 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    102893265 (ADCY2)
   04912 GnRH signaling pathway
    102893265 (ADCY2)
   04913 Ovarian steroidogenesis
    102893265 (ADCY2)
   04915 Estrogen signaling pathway
    102893265 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    102893265 (ADCY2)
   04921 Oxytocin signaling pathway
    102893265 (ADCY2)
   04926 Relaxin signaling pathway
    102893265 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    102893265 (ADCY2)
   04918 Thyroid hormone synthesis
    102893265 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    102893265 (ADCY2)
   04916 Melanogenesis
    102893265 (ADCY2)
   04925 Aldosterone synthesis and secretion
    102893265 (ADCY2)
   04927 Cortisol synthesis and secretion
    102893265 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102893265 (ADCY2)
   04270 Vascular smooth muscle contraction
    102893265 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    102893265 (ADCY2)
   04971 Gastric acid secretion
    102893265 (ADCY2)
   04972 Pancreatic secretion
    102893265 (ADCY2)
   04976 Bile secretion
    102893265 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102893265 (ADCY2)
   04727 GABAergic synapse
    102893265 (ADCY2)
   04725 Cholinergic synapse
    102893265 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    102893265 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102893265 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    102893265 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    102893265 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102893265 (ADCY2)
   04714 Thermogenesis
    102893265 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102893265 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    102893265 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102893265 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102893265 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102893265 (ADCY2)
   05163 Human cytomegalovirus infection
    102893265 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102893265 (ADCY2)
Enzymes [BR:pale01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102893265 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 102893265
NCBI-ProteinID: XP_015448899
LinkDB
Position
Unknown
AA seq 1023 aa
MNEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSVVIWLCLVAMAHLFMCFG
GTVSPWDQVSFFLFIIFVVYTMLPFSMRDAIIASVLTTSSHTIVLSVCLSATPGAKEHLV
WQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQERLLLSLL
PAHIAMEMKAEIIQRLQGPKAGHMENTNNFHNLYVKRHTNVSILYADIVGFTRLASDCSP
GELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVKMGLDMCEA
IKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHIS
SVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHALDGAKM
RASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTMDVPMGQHNFQNRTLRTKSQKKR
FEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKILEKEYRATALPAFKYYVTCAC
LIFFCIFVVQILVLPKTSILGISFGAASLSLAFILFVCFAGQLLQCSKKASASLLWLLKS
SGVIANRPWPQISLTVITTAIVLTMAVFNMFFLSDSEEAIPSTANTSNTSLSASSNQAAI
LRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMSIMTAALVGYNTVFLHTHAHVLDSY
SQVLFERPGIWKDLKTMGSVSLFIFFATLLVLGRQNEYYCRLDFLWKNKFKKEREEIETM
ENLNRVLLENVLPAHVAEHFLARSLKNEDLYHQSYACVCVMFASIPDFKEFYTESDVNKE
GLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHAQEPERQYL
HIGTMVEFAFALGAKLTAINKHCNNDFCCAAGMNHGPVIAGVIGAQKPQYDIWGNTVNVA
SRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGELKTYFVNTEMSGSLSQSN
LAA
NT seq 3072 nt   +upstreamnt  +downstreamnt
atgaacgaagttgaagaccacgtggcatttttgatcacggtccccaccgccctggcgatt
ttcttcgcgatattcatcctcgtgtgcatcgagtccgtgtttaagaagctgctccgcctc
ttctctgtggtcatatggctctgtctcgtcgccatggcacacttgttcatgtgttttgga
ggcactgtctctccctgggaccaggtgtcattcttcctcttcatcatcttcgtggtgtac
accatgctgcccttcagcatgcgagacgccatcatcgccagcgtgctcacgacttcctcc
cacaccatcgtgctgagcgtctgcctgtctgcaacgcccggggccaaggagcacctggtc
tggcagatcctggccaacgtgatcatcttcatctgcgggaacctggcgggtgcgtaccac
aagcacctcatggagctcgctctgcagcagacctatcaggacacctgcaattgcatcaag
tccaggatcaagttggaatttgaaaagcgtcagcaggagcggctcctgctctccctgctg
ccggcccacatagccatggaaatgaaagctgagatcatccagaggctgcagggccccaaa
gccggccacatggaaaacacgaacaacttccacaacctgtacgtcaagcgacacaccaac
gtcagtatcctgtatgctgacattgtggggttcacccggctggccagtgactgctcccca
ggagagctggtccacatgctgaatgaactctttgggaaattcgatcaaattgcaaaggag
aatgaatgcatgagaataaaaatcttaggagactgctattactgcgtgtctggactccca
atctccctccctaaccacgccaagaactgtgtgaaaatggggctggatatgtgtgaagcc
ataaagaaagtgagagatgctacaggagtcgacatcaacatgcgcgtgggggtgcattcc
gggaatgtcctctgcggcgtgattggtctgcagaagtggcagtacgatgtgtggtcccat
gacgtcaccttggccaatcacatggaagccggaggggttcccggacgcgtccacatttcc
tctgtcaccctggagcacttgaacggggcttataaggtggaagaaggggacggcgacatc
agggacccgtacttaaagcagcacctggtgaagacctacttcgtgatcaaccccaaggga
gaacgacggagtccccagcacctcttcagacctcgccacgccctcgatggagccaagatg
agggcgtccgtgcgcatgacccggtacctggagtcgtggggggcggccaagccctttgcg
cacctgcaccacagagacagcatgaccacggagaacggcaagatcagcaccatggatgta
ccaatgggtcagcataactttcaaaatcgcaccttaagaaccaagtcacaaaagaaaagg
tttgaagaagaactgaatgaaaggatgattcaagcaattgatggaattaatgcccaaaag
caatggctcaagtctgaagacattcaaagaatctcattgcttttctacaataaaatacta
gaaaaagagtaccgagccacggcgctgccggccttcaagtattacgtgacctgcgcttgc
ctcatcttcttctgcatcttcgtcgtgcagattctcgtgttgccgaaaacgtccattctc
gggatctccttcggagctgcgtctctctcgcttgccttcatccttttcgtctgcttcgct
ggacagcttttgcaatgcagcaaaaaggcctccgcctccctcctgtggcttttgaagtcg
tcgggtgtcatcgcgaaccgcccgtggccccagatctcgctcacggtcatcaccacggct
atcgtcctaaccatggccgtgttcaacatgtttttcctgagcgactcagaggaagcaatc
ccttccaccgccaatacgtcaaacacgagtctttctgcctcgagtaatcaggcggccatt
ctgcgtgcacaaaacctgtttttccttccgtactttatctacagctgcattctgggattg
atatcctgctccgtgttcctgcgggtgaattacgagctgaaaatgtccatcatgacggcg
gcgttggtgggctacaacaccgtcttcctccacacccacgcccacgtcctggacagctac
agccaggtcttgtttgagagaccaggtatttggaaagacttaaagaccatgggctcggtg
tctctcttcatcttcttcgccaccctgctcgttctgggtagacagaatgaatattactgt
aggttagacttcttgtggaagaacaagttcaaaaaagagcgggaggagatagagaccatg
gagaacctgaaccgcgtgctgctggagaacgtgcttcctgcgcacgtggctgagcacttc
ctggccaggagcctgaagaacgaggatttataccaccagtcctacgcctgtgtctgcgtc
atgttcgcctccatcccggacttcaaggagttctacacggagtcggacgtgaacaaggag
ggcttggaatgcctgcggctcctcaacgagatcatcgccgactttgacgacctgctgtcc
aagccaaaattcagtggagttgaaaagatcaagaccatcgggagcacatacatggcagcg
acgggtctgagcgccgtgcccagccaggagcacgcccaggagcccgagcgccagtacctg
cacatcggcaccatggtggagttcgccttcgcgctgggggccaagctgaccgccatcaac
aagcattgcaataatgatttctgctgtgccgcaggcatgaaccacggccccgtgatcgct
ggtgtgatcggcgcccagaagccacagtatgacatctggggcaacaccgtcaacgtggcc
agcaggatggacagcaccggagtcctggacaagatacaggtgacggaggagaccagcctc
atcctgcagaccctggggtacacgtgcacgtgtcgaggaataatcaacgtgaaagggaag
ggggagctgaagacgtacttcgtgaacacggagatgtctgggtccctgtcccagagcaac
ctggctgcctga

KEGG   Pteropus alecto (black flying fox): 102896789
Entry
102896789         CDS       T02993                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase type 8 isoform X1
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale01100  Metabolic pathways
pale01522  Endocrine resistance
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04072  Phospholipase D signaling pathway
pale04114  Oocyte meiosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04713  Circadian entrainment
pale04714  Thermogenesis
pale04720  Long-term potentiation
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04727  GABAergic synapse
pale04742  Taste transduction
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04913  Ovarian steroidogenesis
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04921  Oxytocin signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04976  Bile secretion
pale05032  Morphine addiction
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102896789 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102896789 (ADCY8)
   04371 Apelin signaling pathway
    102896789 (ADCY8)
   04020 Calcium signaling pathway
    102896789 (ADCY8)
   04072 Phospholipase D signaling pathway
    102896789 (ADCY8)
   04024 cAMP signaling pathway
    102896789 (ADCY8)
   04022 cGMP-PKG signaling pathway
    102896789 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102896789 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102896789 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102896789 (ADCY8)
   04062 Chemokine signaling pathway
    102896789 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    102896789 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    102896789 (ADCY8)
   04912 GnRH signaling pathway
    102896789 (ADCY8)
   04913 Ovarian steroidogenesis
    102896789 (ADCY8)
   04915 Estrogen signaling pathway
    102896789 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    102896789 (ADCY8)
   04921 Oxytocin signaling pathway
    102896789 (ADCY8)
   04926 Relaxin signaling pathway
    102896789 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    102896789 (ADCY8)
   04918 Thyroid hormone synthesis
    102896789 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    102896789 (ADCY8)
   04916 Melanogenesis
    102896789 (ADCY8)
   04925 Aldosterone synthesis and secretion
    102896789 (ADCY8)
   04927 Cortisol synthesis and secretion
    102896789 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102896789 (ADCY8)
   04270 Vascular smooth muscle contraction
    102896789 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    102896789 (ADCY8)
   04971 Gastric acid secretion
    102896789 (ADCY8)
   04972 Pancreatic secretion
    102896789 (ADCY8)
   04976 Bile secretion
    102896789 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    102896789 (ADCY8)
   04727 GABAergic synapse
    102896789 (ADCY8)
   04725 Cholinergic synapse
    102896789 (ADCY8)
   04720 Long-term potentiation
    102896789 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    102896789 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    102896789 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    102896789 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    102896789 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    102896789 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102896789 (ADCY8)
   04714 Thermogenesis
    102896789 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102896789 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    102896789 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102896789 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102896789 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102896789 (ADCY8)
   05163 Human cytomegalovirus infection
    102896789 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102896789 (ADCY8)
Enzymes [BR:pale01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102896789 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 102896789
NCBI-ProteinID: XP_006912984
LinkDB
Position
Unknown
AA seq 1253 aa
MELSDVRCLSGSEELYTIHPTPPAGDGDGESGSRPQRLLWQTAVRHITEQRFIHGHRGGG
GGGSGGSGKGSEPAGSGPNHHASQLSSDSALPLYSLGPGERAHSTGGTKVFPERSGSGSA
SGSGGGGDLGFLHLDCAPSNSDFFLSGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQR
RKSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTS
HTYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLG
TSLLQVVLQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVE
ARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHPQHQFHRIYIHRYENVSILFA
DVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDH
AHCCVEMGLGMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIAN
KLESGGIPGRIHISKATLDCLGGDYKVEEGHGKERNEFLRKHDIETYLIKQPEESLLALP
EDIVKESVSASDRRNSGATFVEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQAL
HVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVC
AFIVLLFITAIQSLLPSSRAMPMAIQFSILIMLHSALVLITTAEDYKCLPLVLRKTCCWI
NETYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVF
TGVLAMVTCAVFLRLNSVLKLAVLLIMIAVYALLTETVYAGLFLRYDHLNHSGEDFLGTK
EASLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSH
VARHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADF
DELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQRCEDKWGHLCALADFSLALTESIQEIN
RHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYV
ILKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRVPGQYSLAAVVLG
LVQSLNRQRQKQLLSENNATGIIKSHYNRRTLLTPSGPEPGAQAEGTDKSDLP
NT seq 3762 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgcctgagcggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcgacggcgagagcggctctcggccgcagcggctgctgtgg
cagacggcggtgcggcacatcacggagcagcgcttcattcacgggcaccggggcggcggc
ggcggcgggagcggaggctcgggcaaaggctcggagccggcaggcagcggccccaaccac
cacgcgtcgcagctgtccagcgactcggcgctgcccctttactcgctgggccccggggag
cgagcacacagcacgggcggcaccaaagtcttcccggaacgcagtgggagcggcagcgcc
agtggcagcgggggcgggggcgacctgggcttcctgcaccttgactgcgccccgagcaac
tcggatttcttcctcagtgggggctacagctaccgaggggtcattttccccaccctgcgc
aactccttcaagtcccgggatctggagcgcctgtaccagcgctatttcctgggccagagg
cgcaaatccgaggtggtgatgaatgtgctggacgtgctgaccaaactcaccctcttggtt
ctccacttgagcctggcctcggcccccatggacccgctcaagggcatcctgctgggcttc
ttcacgggcatcgaggtggtgatctgcgccctggtggtggtcaggaaggacaccacctcg
cacacgtacctgcagtacagcggcgtggtcacctgggtagccatgaccacccagatcttg
gcagcaggccttggctacgggcttctgggcgatggcatcggctatgtgctcttcacactc
ttcgccacctatagcatgctgccgctgccgctcacctgggccatcttggcgggcctgggc
acctccttgctgcaggtggtcctccaagtggtcatcccccggctggcggtcatttccatc
aaccaggttgtggcccaggcagtgttattcatgtgtatgaacacagctggaatcttcatc
agttacctgtcagaccgggcccagcgccaggccttcctggagacgcggaggtgtgtggag
gccaggctgcgtctggagacagaaaaccaaagacaggagcggctcgtgctgtccgtgctc
ccccggtttgtcgtcctggaaatgatcaacgacatgaccaacgtggaggacgagcaccca
cagcaccagttccatcggatctacatccatcgctatgagaacgtcagtattctttttgca
gatgttaaaggatttaccaacctctccacgaccttgtccgctcaggagctggtcaggatg
ctcaacgagctctttgccagatttgatcgactggcccacgagcatcactgtcttcgtatc
aaaatcctgggggactgctactactgcgtctccggacttccggagccccgccaggaccac
gcccactgctgtgtggaaatgggcctcggcatgatcaagaccatcaggtatgtgaggtca
aggacgaagcatgacgttgacatgcggatcggaatccactccggctccgtgctgtgtggc
gtgttgggccttcggaagtggcagtttgacgtctggtcttgggacgtggacattgcaaac
aaacttgaatctggaggaatccctgggaggattcacatctccaaagccacactggactgc
ctgggcggcgactataaggtggaggagggccacggcaaggagaggaacgagttcttgcgg
aagcacgacatagagacctatttaattaagcagcccgaggagagcctgctggccctgccc
gaagacattgtcaaggagtcggtgagcgcctcggacaggaggaacagcggggccaccttc
gtggaaggatcctggagccccgagctgcccttcgacaacatagttgggaagcagaacact
ctggctgccctaacaagaaattcaataaatctacttccaaaccatcttgcacaagctttg
catgtccagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcgg
agtggcgataaattgcgaagagagcatatcaagccattctcactgatgtttaaagactcc
agcctggagcacaagtattctcaaatgagggatgaagttttcaagtcaaacttggtctgt
gcgtttatcgttctgctgtttatcacggcaatccaaagtttgcttccttcttcaagggcg
atgcccatggccatccagttttccatcctgatcatgctgcattcagctctggttctcatc
accacggcagaggattataagtgtttgcccctcgtcctccggaaaacttgctgttggatc
aacgagacctatttggcccggaatgtcatcattttcgcgtccatcttgatcaatttcctg
ggcgccatcctaaatatcctgtggtgtgattttgacaagtcgatccctttgaagaacctg
actttcaattcctcagctgtgtttacagatatctgctcctacccagagtacttcgtcttc
acgggggtgttggccatggtgacctgtgcggtgttcctccgacttaactccgtcctgaag
ctggccgtgctgctgatcatgatcgctgtctacgccctgctgactgagaccgtctacgcg
ggtctctttctgcgctatgaccacctgaaccacagtggagaagatttcctggggaccaaa
gaggcatcgctgctgctgatggccatgttcctccttgctgtgttctaccacggacagcag
ctggagtacacggcccgcctggacttcctctggcgagttcaggccaaggaggagatcaac
gagatgaaggagctgagggagcacaatgagaacatgctgcgcaacatcctgcccagccac
gtggcccgccacttcctggagaaggaccgagacaatgaggagctgtattctcagtcctac
gatgctgtcggcgtgatgttcgcctccatcccggggttcgcagacttctactctcagacc
gagatgaacaaccaaggagtggagtgcctgcgccttctgaacgagatcattgccgacttc
gatgagctgctcggcgaagaccggtttcaagacattgagaagatcaagaccatcggcagc
acctacatggccgtgtcaggcctgtcacctgaaaaacagcgatgtgaagataagtgggga
cacctgtgtgccctggccgacttctctctcgctctgaccgagagcatccaagagatcaac
aggcattcgttcaacaacttcgaactccggatcggcatcagccacggctccgtggtggct
ggcgtcatcggcgctaagaaaccgcagtacgacatttggggcaaaaccgtgaacctggcc
agtcggatggacagcacaggggtcagcggcaggatccaagtcccagaggagacctacgtc
atcctgaaggaccagggctttgcctttgactaccgaggggagatctacgtgaagggcatc
agcgagcaggaaggcaagatcaaaacatactttctcctgggcagagtccagcccaacccg
ttcatcttgcccccgagaagggtgcccgggcagtactccttggccgccgtcgtcctgggc
ctcgtccagtccctcaacaggcaaaggcagaagcagctgctcagcgagaacaacgccacg
gggatcatcaagagccactacaaccggcggactttgctcacccccagcgggccggagccc
ggcgcccaggccgagggcaccgacaagtccgatttgccataa

KEGG   Pteropus alecto (black flying fox): 102897495
Entry
102897495         CDS       T02993                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale01100  Metabolic pathways
pale01522  Endocrine resistance
pale04015  Rap1 signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04072  Phospholipase D signaling pathway
pale04114  Oocyte meiosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04713  Circadian entrainment
pale04714  Thermogenesis
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04727  GABAergic synapse
pale04728  Dopaminergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04913  Ovarian steroidogenesis
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04921  Oxytocin signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04924  Renin secretion
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04976  Bile secretion
pale05012  Parkinson disease
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05032  Morphine addiction
pale05034  Alcoholism
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102897495 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102897495 (ADCY5)
   04371 Apelin signaling pathway
    102897495 (ADCY5)
   04072 Phospholipase D signaling pathway
    102897495 (ADCY5)
   04024 cAMP signaling pathway
    102897495 (ADCY5)
   04022 cGMP-PKG signaling pathway
    102897495 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102897495 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102897495 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102897495 (ADCY5)
   04062 Chemokine signaling pathway
    102897495 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    102897495 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    102897495 (ADCY5)
   04912 GnRH signaling pathway
    102897495 (ADCY5)
   04913 Ovarian steroidogenesis
    102897495 (ADCY5)
   04915 Estrogen signaling pathway
    102897495 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    102897495 (ADCY5)
   04921 Oxytocin signaling pathway
    102897495 (ADCY5)
   04926 Relaxin signaling pathway
    102897495 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    102897495 (ADCY5)
   04918 Thyroid hormone synthesis
    102897495 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    102897495 (ADCY5)
   04916 Melanogenesis
    102897495 (ADCY5)
   04924 Renin secretion
    102897495 (ADCY5)
   04925 Aldosterone synthesis and secretion
    102897495 (ADCY5)
   04927 Cortisol synthesis and secretion
    102897495 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102897495 (ADCY5)
   04270 Vascular smooth muscle contraction
    102897495 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    102897495 (ADCY5)
   04971 Gastric acid secretion
    102897495 (ADCY5)
   04972 Pancreatic secretion
    102897495 (ADCY5)
   04976 Bile secretion
    102897495 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    102897495 (ADCY5)
   04727 GABAergic synapse
    102897495 (ADCY5)
   04725 Cholinergic synapse
    102897495 (ADCY5)
   04728 Dopaminergic synapse
    102897495 (ADCY5)
   04726 Serotonergic synapse
    102897495 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    102897495 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102897495 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    102897495 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    102897495 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102897495 (ADCY5)
   04714 Thermogenesis
    102897495 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102897495 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102897495 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    102897495 (ADCY5)
   05031 Amphetamine addiction
    102897495 (ADCY5)
   05032 Morphine addiction
    102897495 (ADCY5)
   05034 Alcoholism
    102897495 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102897495 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102897495 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102897495 (ADCY5)
   05163 Human cytomegalovirus infection
    102897495 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102897495 (ADCY5)
Enzymes [BR:pale01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102897495 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA DUF2339 TBK1_ULD
Other DBs
NCBI-GeneID: 102897495
NCBI-ProteinID: XP_006905658
LinkDB
Position
Unknown
AA seq 1181 aa
MSGSKSVSPPGYAAQTAAAPASRGGPEHRSAWGEADARANGYPHAPGGSARGSTKRPGGA
VTPQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRGSLAGSGAGPGPVLSLGACCLA
LLQIFRSKKFPSDKLERLYQRYFFRLNQSSLTMLMAVLVLVCLVMLAFHAARPPLQLPYL
GVLAAAVGVILVMAVLCNRAAFHQDHMGLACYALIAVVLAVQVVGLLLPQPRSASEGIWW
TVFFIYTIYTLLPVRMRAAVLSGVLLSALHLAIALRTNAQDQFLLKQLVSNVLIFSCTNI
VGVCTHYPAEVSQRQAFQETRECIQARLHSQRENQQQERLLLSVLPRHVAMEMKADINAK
QEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCL
RIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREVTGVNVNMRVGIHSGRVH
CGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLNYLNGDYEVEPGCGGERNAY
LKEHSIETFLILRCTQKRKEEKAMIAKMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSK
EMKRMGFEDPKDKXXXXXXNPEDEVDEFLGRAIDARSIDRLRSEHVRKFLLTFREPDLEK
KYSKQVDDRFGAYVACASLVFLFICFVQITIVPQKGPGVMLVLERDDGGGRAGSVVVREV
PAEFCSVSHLPTPQLFPAPLQTLSRKIVRSKVNSTLVGVFTITLVFLAAFVNMFMCNSKD
LFGCLADEHNISTSQVNACHVVESAFNYSLGDEQGFCGSPWPNCNFPEYFTYSVLLSLLA
CSVFLQISCIGKLVLMLAIELIYVLVVEVPGVTLFDNADLLVTANAIDFNNNGTSQCPEH
ATKVALKVVTPIVISVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEELQAYNRRLL
HNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLL
NEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKVGKTHIKALADFAMKLMD
QMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQV
TTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
NT seq 3546 nt   +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtgagccccccgggctacgcggcgcagacagccgcggcgcca
gcgtcccggggaggcccggaacaccgctccgcgtggggagaggccgatgcccgcgccaat
ggctacccccacgcccccggcggttcggcccgcggctccaccaagagacccgggggggcg
gtgaccccgcagcagcagcagcgcctggccagccgctggcgcagcgacgacgacgacgac
cctccgctgagtggcgacgaccccttggccgggggctttggcttcagcttccgcggcagc
ttggcgggctcgggcgcgggccccggcccggtgctgtcgctgggcgcctgctgcctggca
ctgctgcagatattccgctccaagaagttcccgtcggacaagctggagcggctgtaccag
cgctacttcttccgtctgaaccagagcagcctgaccatgctcatggccgtgctagtgctc
gtgtgcctcgtcatgttggccttccacgcggcgcggcctccgctccagctgccctacctg
ggcgtgctggcggccgccgtgggcgtgatcctcgtcatggccgtgctctgcaaccgcgcc
gcctttcaccaggaccacatgggcctggcctgctacgcgctcatcgcggtggtgctggcc
gtccaggtggtgggcctgctgctgccccagccacgaagcgcctccgagggcatctggtgg
acggtgttcttcatctacaccatctacacactgctacccgtgcgcatgcgggccgcagta
ctcagcggggtgctcctgtctgccctccacctggccatcgccctgcgaaccaacgcccag
gaccagttcctgctcaaacagctggtctccaatgtcctcattttctcctgcaccaacatc
gtgggtgtctgcacccactatccggcagaggtctcccagagacaggccttccaggagacc
cgggagtgtatccaggcacggctccactcacagcgggagaaccagcagcaggagcggctc
ctgctgtctgtccttccccgtcatgttgccatggagatgaaagcagacatcaacgccaag
caggaggatatgatgttccataagatttacatccagaaacatgacaatgtgagcatcctg
tttgctgacatcgagggcttcaccagcctggcgtcccagtgcacggcccaagagctggtt
atgaccctcaacgagctcttcgcccgcttcgacaagctggctgcggagaatcactgttta
cgtattaagatcctgggggattgttattactgtgtctcggggctgcctgaagcgagggct
gaccacgcccactgctgtgtggagatgggcatggacatgattgaggccatctcgttggtc
cgggaggtgacaggggtgaacgtgaacatgcgcgtgggaattcacagcgggcgagtacac
tgcggtgtccttggtctcaggaagtggcaattcgacgtctggtctaacgacgtcacgctg
gccaaccacatggaggctggaggcaaggctggacgcatccacatcaccaaggccacactc
aactacctgaatggagactacgaggtggagccgggctgtgggggcgagcgcaatgcctac
ctcaaggagcacagcatcgagaccttcctcatcctgcgctgcacccagaagcggaaagaa
gagaaggccatgatcgccaagatgaatcgccagagaaccaactccattgggcacaacccg
ccgcactggggggctgagcgccccttctacaaccacttgggcggcaaccaggtgtccaag
gagatgaagcggatgggcttcgaagaccccaaggacaagnnnnnnnnnnnnnnnnnnaac
cccgaggatgaagtggatgaattcctgggccgagccatcgacgccaggagtattgacagg
ctgcggtctgagcatgttcgcaagttcctcttgaccttcagggagcctgacttagagaag
aagtactccaagcaggtggatgaccgattcggtgcctatgtggcgtgtgcctcgcttgtc
ttcctcttcatttgctttgtccagatcaccatcgtgccccagaagggtcctggggttatg
ctggtgctggagagagacgacggtggagggagggctggttctgtggtggttcgtgaagtg
cccgctgaattctgttctgtctctcatctccccaccccacagctcttccccgcccctctg
cagaccctctccaggaagatcgtgcggtccaaggtgaacagcaccctggttggggtgttc
accatcaccctggtgttcctggcagcatttgtcaacatgttcatgtgcaactccaaggac
ctattcggctgcctggcggatgagcacaacatcagcaccagccaggtcaacgcttgccac
gtggtggagtcggccttcaactacagcctgggtgacgagcagggattctgtggcagcccc
tggcccaactgcaacttccctgagtacttcacctacagcgtgctgctcagcctgctggcc
tgctccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatcgag
ctcatatatgtgctcgtcgtcgaagtgcccggtgtcacactctttgacaatgcagacctg
ctagtcaccgccaacgccatagacttcaacaacaacgggacctcccagtgccctgagcac
gcgaccaaagtggcgctgaaggtggtgacgcccattgtcatctcagtctttgtgctggcc
ctgtacctgcacgcccagcaggtggagtccaccgcccgcctcgacttcctctggaaactg
caggccacggaggagaaggaggagatggaggagctgcaggcctacaaccggcggctgctg
cacaacatcctgcccaaggacgtggccgcccacttcctggcccgtgagcggcgcaacgac
gagctctactatcagtcgtgtgagtgtgtggccgtcatgttcgcctccatcgctaacttc
tccgagttctatgtggagctggaggccaacaacgagggtgtcgagtgcttgcggctgctt
aatgaaatcatcgccgattttgacgagatcatcagcgaggatcggttcaggcagctggaa
aagatcaagaccattggcagcacctacatggctgcctcaggcctcaatgattccacctat
gacaaggtgggcaagacccacatcaaggctctggccgacttcgccatgaagctgatggac
cagatgaagtacatcaacgagcactccttcaacaacttccagatgaagattgggctcaat
attggccccgtggtggccggggtgatcggggcccgcaagcctcagtacgacatctggggc
aatacggtgaatgtggccagccgcatggacagcacaggtgtgcctgaccgcatccaggtc
accacggacatgtatcaggtgctggctgccaacacataccagctggagtgccggggtgtg
gtcaaggtcaagggcaaaggcgagatgatgacctacttcctcaacggagggcccccgctc
agttag

DBGET integrated database retrieval system