KEGG   Pteropus alecto (black flying fox): 102881572
Entry
102881572         CDS       T02993                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha
  KO
K08524  retinoid X receptor alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale03320  PPAR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04659  Th17 cell differentiation
pale04919  Thyroid hormone signaling pathway
pale04920  Adipocytokine signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale04932  Non-alcoholic fatty liver disease
pale04976  Bile secretion
pale05160  Hepatitis C
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05216  Thyroid cancer
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102881572 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102881572 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102881572 (RXRA)
   03320 PPAR signaling pathway
    102881572 (RXRA)
   04919 Thyroid hormone signaling pathway
    102881572 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    102881572 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    102881572 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102881572 (RXRA)
   05202 Transcriptional misregulation in cancer
    102881572 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    102881572 (RXRA)
   05216 Thyroid cancer
    102881572 (RXRA)
   05222 Small cell lung cancer
    102881572 (RXRA)
   05223 Non-small cell lung cancer
    102881572 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102881572 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102881572 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102881572 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pale03310]
    102881572 (RXRA)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    102881572 (RXRA)
Nuclear receptors [BR:pale03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   102881572 (RXRA)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 102881572
NCBI-ProteinID: XP_006918154
UniProt: L5K749
LinkDB
Position
Unknown
AA seq 439 aa
MAAPSLHPSLGPGLGASLGSPGQLPSPISTLSSPVNGMGPPFSVISSPMGPHSMSVPTTP
TLGFSTSSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE
AVQEERQRGKDRSEAEAEPASSANEDMPVEKILEAELAVEPKTETYVEANMGLNPSSPND
PVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMHMDKTELGCLRAIVLFNPDSKGL
SNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQLT
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggccgcgccctcgctgcacccgtccctggggcctggcctcggcgcctcgctgggctcc
ccaggacagctgccctcacccatcagcacgctgagctcccctgtcaacggcatgggcccg
cccttctcggtcatcagctcccccatgggcccccactccatgtccgtgcccaccacgccc
accctgggcttcagcaccagcagcccccagctcagctcgcccatgaaccccgtcagcagc
agtgaggacatcaagcccccgctgggcctcaatggtgtcctcaaagtccccgcccacccc
tcagggaacatggcgtccttcaccaagcacatctgtgccatctgcggggaccgctcctca
ggcaagcactacggcgtgtacagctgcgagggttgcaagggcttcttcaagcgcacggtg
cgcaaggacctgacctacacctgccgggacaacaaggactgcctgatcgacaagcgccag
cgcaaccgctgccagtactgccgctaccagaagtgcctggccatgggcatgaagcgcgaa
gctgtgcaggaggagaggcagcggggcaaggaccgcagtgaggccgaggcggagcccgcg
agcagcgccaacgaggacatgcccgtggagaagattctggaggccgagctggcggtcgag
cccaagactgagacgtacgtggaggccaacatggggctgaaccccagctcgcccaacgac
cccgtcaccaacatctgccaagcagcggacaagcagctcttcaccctggtcgagtgggcc
aagcggatcccgcacttctccgagctgccgctggacgaccaggtcatcctgctgagggcc
ggctggaacgagctgctcatcgcctccttctcccaccggtccatcgccgtgaaggacggg
atcctcctggccaccgggctgcacgtgcaccggaacagcgcccacagcgccggcgtgggc
gccatcttcgacagggtgctgacggagctggtgtccaagatgcgggacatgcacatggac
aagacggagctgggctgtctgcgcgccatcgtgctcttcaaccccgactccaaggggctc
tcgaacccggccgaggtggaggcactgcgggagaaggtgtatgcgtccctggaggcctac
tgcaaacacaagtaccccgagcagccagggaggttcgccaagctgctgctgcgcctgccg
gccctgcgctccatcggcctcaagtgcctggagcacctcttcttcttcaagctcatcggg
gacacgcccatcgacaccttcctcatggagatgctggaggccccgcaccagctgacctag

KEGG   Pteropus alecto (black flying fox): 102888877
Entry
102888877         CDS       T02993                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X1
  KO
K08525  retinoid X receptor beta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale03320  PPAR signaling pathway
pale04659  Th17 cell differentiation
pale04919  Thyroid hormone signaling pathway
pale04920  Adipocytokine signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05216  Thyroid cancer
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102888877 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102888877 (RXRB)
   03320 PPAR signaling pathway
    102888877 (RXRB)
   04919 Thyroid hormone signaling pathway
    102888877 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    102888877 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102888877 (RXRB)
   05202 Transcriptional misregulation in cancer
    102888877 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    102888877 (RXRB)
   05216 Thyroid cancer
    102888877 (RXRB)
   05222 Small cell lung cancer
    102888877 (RXRB)
   05223 Non-small cell lung cancer
    102888877 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102888877 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pale03310]
    102888877 (RXRB)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    102888877 (RXRB)
Nuclear receptors [BR:pale03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   102888877 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 102888877
NCBI-ProteinID: XP_006907450
LinkDB
Position
Unknown
AA seq 535 aa
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAATAAAAAAGEQQTP
EPEPGEAGRDGMGDSGRDSGSPDSSSPNPLPQGAPPHSPGPPLPPSAAPSLGGSGAPPPP
PMPPPPLSSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPP
VLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCR
DNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPVD
RILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSS
LPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRSLS
RVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQK
YPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgtcctgggctgctcgcccgcccttcctcccccagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcgtcccggtggcggcggcgacgg
ccctggctggatcccgcagcaacggcggcggcggcggcagccggagaacaacaaaccccg
gagccggagccaggggaggctggacgggacgggatgggagacagcgggcgggattccgga
agcccagacagttcctccccaaatccccttccccagggtgctcctccccattctcctggg
ccacccctacccccttcagcagccccatcccttggaggctctggggcgccacccccaccc
ccaatgccaccacccccactgagctcccccttcccagttatcagctcttccatggggtcc
cctggtctgccccctccagctcccccaggattctccgggcctgtcagcagtccccagatt
aactcaacagtgtcgctccctgggggtgggtctggcccccctgaagatgtgaagccacca
gtcttaggggtccggggcctgcactgtccaccccctccaggtggccctggggctggcaaa
cggctatgtgcaatctgcggggaccgaagctcaggcaaacactatggagtttacagttgt
gagggctgcaaaggctttttcaagcgcaccattcgtaaggacctgacctactcatgccgg
gacaacaaagactgcacggtggataagcgtcagcggaaccgctgtcagtactgccgctat
cagaagtgcctggctactggtatgaagagggaagcggtacaggaggagcgtcagcggggg
aaagacaaggatggggatggggagggggccgggggagcccccgaggagatgcctgtggac
aggatcctggaggcagagcttgctgtggagcagaagagtgaccagggcgttgagggtcct
gggggaaccgggggtagcggcagcagcccaaatgaccctgtgactaacatctgtcaggca
gctgacaaacagctattcacacttgttgagtgggcgaagaggatcccacacttttcttcc
ttgcctctggatgaccaggtcatattgctacgggcaggctggaatgagctcctcattgcc
tccttctcccaccgatccattgatgtacgagatggcatcctccttgccacaggtcttcac
gtgcaccgcaactcagctcattctgcaggcgtgggagccatctttgatcggtccctctcc
agggtgctgacagagctagtgtccaaaatgcgtgacatgaggatggacaagacagagctt
ggctgcctgagggcaatcattctgttcaatccagatgccaagggtctttccaatcccagt
gaggtagaggtccttcgggagaaagtgtatgcatcactggaaacctattgcaaacagaag
taccctgagcagcagggacggtttgccaagctgctgctacgtcttcctgccctcaggtcc
attggccttaaatgtctagagcatctgtttttcttcaagctcattggtgacacccccatt
gacaccttcctcatggagatgctcgaggcaccccaccagctggcctga

KEGG   Pteropus alecto (black flying fox): 102897820
Entry
102897820         CDS       T02993                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma
  KO
K08526  retinoid X receptor gamma
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale03320  PPAR signaling pathway
pale04659  Th17 cell differentiation
pale04919  Thyroid hormone signaling pathway
pale04920  Adipocytokine signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05216  Thyroid cancer
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102897820 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102897820 (RXRG)
   03320 PPAR signaling pathway
    102897820 (RXRG)
   04919 Thyroid hormone signaling pathway
    102897820 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    102897820 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102897820 (RXRG)
   05202 Transcriptional misregulation in cancer
    102897820 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    102897820 (RXRG)
   05216 Thyroid cancer
    102897820 (RXRG)
   05222 Small cell lung cancer
    102897820 (RXRG)
   05223 Non-small cell lung cancer
    102897820 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102897820 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pale03310]
    102897820 (RXRG)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    102897820 (RXRG)
Nuclear receptors [BR:pale03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   102897820 (RXRG)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 102897820
NCBI-ProteinID: XP_015441712
LinkDB
Position
Unknown
AA seq 340 aa
MNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLVYTCRDNKDCLI
DKRQRNRCQYCRYQKCLVTGMKREAVQEERQRSRERAEDEAECAAGGRGDMPVGRILEAE
LAVEPKTESYGDVNVESSMNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLR
AGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQM
DKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLLLRL
PALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQVT
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgaactacccgtccaccagccctggctctctggtcaaacacatctgtgccatctgtgga
gacagatcctcaggaaagcactacggcgtgtacagctgcgaaggctgcaaagggttcttc
aagaggacgatccggaaggacctcgtctacacctgccgggacaacaaggactgcctgatc
gacaagcgccagcgcaaccgctgccagtactgccgctaccagaagtgcctggtcacgggc
atgaagcgcgaagccgtgcaggaggagaggcagaggagccgggagcgggcggaggacgag
gcggagtgcgctgccgggggccgcggagacatgcccgtggggaggattctagaagctgag
ctcgctgtcgaaccaaagacggagtcctacggcgacgtgaacgtggagagctcgatgaat
gaccctgtcaccaacatatgccacgctgccgacaagcagctcttcacgctcgtcgagtgg
gccaagcgcatcccgcacttctctgacctcaccttggaggaccaggtcattctgctccgg
gcaggctggaacgagctgctgatcgcctccttttcccaccgctcggtgtccgtgcaggac
gggatcctcctggccacgggtctgcacgtccaccgcagcagcgcccacagtgccggggtg
ggctccatctttgacagagtcctgactgagctggtctccaagatgaaggacatgcagatg
gacaagtcggagctgggctgcctgcgagccatcgtgctgtttaacccagatgccaagggt
ctgtccaacccctctgaggtggagactctgcgggagaaggtctacgccaccctcgaggcc
tacaccaagcagaagtacccagagcaaccgggcaggttcgccaagctgctgctgcgcctg
cccgccctgcgctccatcggcctcaaatgcctggagcacctcttcttcttcaagctcatc
ggggacacgcccatcgacaccttcctcatggagatgctggagaccccgctgcaggtcacc
tga

DBGET integrated database retrieval system