KEGG   Pteropus alecto (black flying fox): 102881655
Entry
102881655         CDS       T02993                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale03013  RNA transport
pale04012  ErbB signaling pathway
pale04066  HIF-1 signaling pathway
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04218  Cellular senescence
pale04910  Insulin signaling pathway
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05168  Herpes simplex virus 1 infection
pale05221  Acute myeloid leukemia
pale05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102881655 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102881655 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    102881655 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    102881655 (EIF4EBP1)
   04152 AMPK signaling pathway
    102881655 (EIF4EBP1)
   04150 mTOR signaling pathway
    102881655 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102881655 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102881655 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    102881655 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102881655 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102881655 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102881655 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    102881655 (EIF4EBP1)
   05165 Human papillomavirus infection
    102881655 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102881655 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pale03019]
    102881655 (EIF4EBP1)
Messenger RNA biogenesis [BR:pale03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     102881655 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 102881655
NCBI-ProteinID: XP_006916372
UniProt: L5KAN7
LinkDB
Position
Unknown
AA seq 118 aa
MSGGSSCSQTPSRAIPATRRVVLSDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPAIPGVTSPASDEPPTEACQNHLRNSPEDKPAGGEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtccggaggcagcagctgcagccagaccccaagccgggccatcccggccactcgccgg
gtggtcctaagcgacggcgtgcagctgccgcccggggactacagtaccacccccggcggc
acgctcttcagcaccaccccgggaggtaccaggatcatctatgaccgaaagttcctaatg
gagtgtcggaactcacctgtgaccaaaacacccccacgggacctgcccgccattcccggg
gtcactagccctgccagcgatgagccccccacagaagcctgccagaaccacctgcgcaac
agcccagaagataagcctgcgggtggcgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system