KEGG   Pteropus alecto (black flying fox): 102881703Help
Entry
102881703         CDS       T02993                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00010  Glycolysis / Gluconeogenesis
pale00053  Ascorbate and aldarate metabolism
pale00071  Fatty acid degradation
pale00280  Valine, leucine and isoleucine degradation
pale00310  Lysine degradation
pale00330  Arginine and proline metabolism
pale00340  Histidine metabolism
pale00380  Tryptophan metabolism
pale00410  beta-Alanine metabolism
pale00561  Glycerolipid metabolism
pale00620  Pyruvate metabolism
pale01100  Metabolic pathways
Module
pale_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102881703 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    102881703 (ALDH2)
   00620 Pyruvate metabolism
    102881703 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102881703 (ALDH2)
   00561 Glycerolipid metabolism
    102881703 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102881703 (ALDH2)
   00310 Lysine degradation
    102881703 (ALDH2)
   00330 Arginine and proline metabolism
    102881703 (ALDH2)
   00340 Histidine metabolism
    102881703 (ALDH2)
   00380 Tryptophan metabolism
    102881703 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102881703 (ALDH2)
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102881703 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102881703
NCBI-ProteinID: XP_024901276
LinkDB All DBs
Position
Unknown
AA seq 467 aa AA seqDB search
AAAAPGPRLGRRLLSGAATHGVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPTVNPSTGE
VICQVAEGDKALETLDNGKPYITSYLVDLNKVIKCLRYYAGWADKHHGKTIPIDGDFFSY
TRLEPLGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGF
PPGVVNIVPGFGPTAGAAIASHKDVDKVAFTGSTEVGQLIQVAAGSSNLKRVTLELGGKS
PNIIMSDADMDWAVEQAHFALFFNQGQCCTAGSRTFVQEDVYAEFVERSVTRAKSRVVGN
PFDSRTEQGPQVDETQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDSM
TIAKEEIFGPVMQILKFKTIEEVVERANSSKYGLAAAVFTKDLDKANYVSHALQAGTVWV
NCYDVFEAQAPFGGYKVSGNGRELGEDSLQAYTEVKTVTIKVPQKNS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gctgccgccgcccccgggccccgcctgggccgccgcctcctgtccggcgccgccacccat
ggggtgccggcccccaaccagcagcccgaggtcttctacaatcagatcttcataaacaac
gagtggcatgacgccgtcagcaagaaaacattccccactgtcaatccatccactggggaa
gtcatctgtcaggtagctgaaggggacaaggccttggagaccctggacaatggcaagccc
tacatcacctcctacctggtggatctgaataaggtcatcaaatgtttacgctattatgct
ggctgggctgataagcaccatgggaaaaccattcccatcgatggagacttcttcagttac
acccgcctcgaaccattgggcgtgtgcgggcagatcatcccgtggaatttcccactgttg
atgcaagcatggaaactgggcccagccttggcgactggaaacgtggttgtgatgaaggtg
gctgagcagaccccactcactgccctctatgtggccaacctgattaaggaggctggcttt
ccccctggcgtggtcaatatagttcctggatttggccccacggctggcgctgccattgcc
tcccacaaggatgtggataaagtggccttcacaggctccactgaggttggccagctaatc
caggttgctgcggggagcagtaacctcaagagagtgaccttggagctggggggaaagagc
cccaatatcatcatgtcagatgccgacatggactgggctgtggagcaggcccacttcgcc
ctgttcttcaaccagggccagtgctgcactgcgggctccaggacctttgttcaggaggat
gtttacgccgagtttgtggagcggagcgtcacccgggccaagtctcgggtggttgggaac
ccctttgacagccggactgagcaggggccacaggtggatgaaactcagtttaagaagatc
cttggctatatcaaatctgggaaagaggagggggcaaagttgctatgtggtggaggggca
gccgctgaccgtggctacttcatccagcccactgtgttcggggatgtgcaagacagcatg
accatcgcaaaggaggagatctttgggccagtcatgcagatcctaaagttcaagaccatc
gaggaagtcgtcgagagagccaacagttccaagtacgggctggccgcagctgtcttcacc
aaggacttggacaaagccaattacgtgtcccacgcgctccaggctggtacagtgtgggtt
aactgctatgacgtgtttgaggcccaggcgccatttggtggctacaaggtatctgggaac
ggccgggagctgggagaggacagtctgcaggcctacactgaagtgaaaaccgtcacaatc
aaagttcctcagaagaactcataa

DBGET integrated database retrieval system