KEGG   Pteropus alecto (black flying fox): 102881891
Entry
102881891         CDS       T02993                                 

Gene name
CISH
Definition
(RefSeq) cytokine-inducible SH2-containing protein
  KO
K04701  cytokine inducible SH2-containing protein
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04630  JAK-STAT signaling pathway
pale04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102881891 (CISH)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102881891 (CISH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102881891 (CISH)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pale04990]
    102881891 (CISH)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102881891 (CISH)
Domain-containing proteins not elsewhere classified [BR:pale04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   102881891 (CISH)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 102881891
NCBI-ProteinID: XP_006909204
LinkDB
Position
Unknown
AA seq 257 aa
MVLCVQGLCPLLAVEWIERRPLWAQPLELPEPAMQPLPAGAFLEEVAEEIPAQSESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDNLDPAS
TPALPVPKEDAPGDPALPAPAATAVHLKLVQPFVRRSSTRSLQHLCRLVINRLVADADCL
PLPRRMADYLRQYPFQL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggtcctctgcgtccagggactttgtcctttgctggctgtggagtggatcgagcggcgg
cccctgtgggcccagcccctggagctgcctgagccagctatgcagcctttgcctgctggg
gccttcctggaggaagtggcagaggagatcccggcccagtcagagagtgagcccaaggtg
ctggacccagaggaggatctgctgtgcatagctaagaccttctcctaccttcgcgaatcc
ggctggtactggggttccattacggccagcgaggcccggcagcacctgcagaagatgcca
gagggcacatttctagtgcgggacagcacccaccccagctacctgttcacgctgtctgtc
aaaaccacccgaggccctaccaacgtgcgcattgagtacgccgactccagcttccgcctg
gactccaactgcctgtccaggccacgcatcctggccttcccagatgtggtcagcctggtg
cagcactacgtggcttcctgtgctgctgacacccggagtgacaaccttgaccctgcctca
actccggccctgcccgtccccaaggaagatgcacctggtgacccagcgctgcctgcccct
gcggccactgccgtgcacctgaaactggtacagcccttcgtgcgcaggagcagcacccgc
agcctgcagcacctgtgccgcctggtcatcaaccgcctggtggccgacgcggactgcctg
ccgctcccccggcgcatggccgactacctccgacagtacccctttcagctctga

DBGET integrated database retrieval system