KEGG   Pteropus alecto (black flying fox): 102881949Help
Entry
102881949         CDS       T02993                                 

Gene name
PTEN
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00562  Inositol phosphate metabolism
pale01100  Metabolic pathways
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04068  FoxO signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04071  Sphingolipid signaling pathway
pale04115  p53 signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04218  Cellular senescence
pale04510  Focal adhesion
pale04931  Insulin resistance
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05206  MicroRNAs in cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05222  Small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05230  Central carbon metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102881949 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102881949 (PTEN)
   04070 Phosphatidylinositol signaling system
    102881949 (PTEN)
   04071 Sphingolipid signaling pathway
    102881949 (PTEN)
   04151 PI3K-Akt signaling pathway
    102881949 (PTEN)
   04150 mTOR signaling pathway
    102881949 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102881949 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102881949 (PTEN)
   04218 Cellular senescence
    102881949 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102881949 (PTEN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102881949 (PTEN)
   05206 MicroRNAs in cancer
    102881949 (PTEN)
   05230 Central carbon metabolism in cancer
    102881949 (PTEN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102881949 (PTEN)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102881949 (PTEN)
   05214 Glioma
    102881949 (PTEN)
   05218 Melanoma
    102881949 (PTEN)
   05215 Prostate cancer
    102881949 (PTEN)
   05213 Endometrial cancer
    102881949 (PTEN)
   05224 Breast cancer
    102881949 (PTEN)
   05222 Small cell lung cancer
    102881949 (PTEN)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102881949 (PTEN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102881949 (PTEN)
   05165 Human papillomavirus infection
    102881949 (PTEN)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102881949 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102881949 (PTEN)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102881949 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     102881949 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     102881949 (PTEN)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    102881949 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DUF3256
Motif
Other DBs
NCBI-GeneID: 102881949
NCBI-ProteinID: XP_024898015
LinkDB All DBs
Position
Unknown
AA seq 388 aa AA seqDB search
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRCAERH
YDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMI
CAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLF
HKMMFETIPMFSGGTCNPHFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKV
EFFHKQNKMLKKDKMFHFWVNTFFIPGPDETSEKVENGSLCDQEIDSICSIERADNDKEY
LVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPD
HYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatcatcaaagagatcgttagcagaaacaaaaggagatatcaagaggatgga
ttcgacttagacttgacctatatttatccaaacattattgctatggggtttcctgcagaa
agacttgaaggtgtatacaggaacaatattgacgatgtagtaagatgtgctgaaagacat
tatgatactgccaaatttaactgcagagttgcacagtatccttttgaagaccataatcca
ccacagctagaacttatcaaacccttttgtgaagatcttgaccaatggctaagtgaagat
gacaatcatgttgcggcaattcactgtaaagctggaaagggacgaactggtgtaatgatt
tgtgcatatttgttacatcggggcaaatttttaaaggcacaagaggccctagatttctat
ggggaagtaaggaccagagacaaaaagggagtaactattcccagtcagagacgctatgtg
tattattatagctacctgttaaagaatcatctggactatagaccagtggcactgttgttt
cacaagatgatgtttgaaactattccaatgttcagtggcggaacttgcaatcctcatttt
gtggtctgccagctaaaggtgaagatatattcctccaattcaggacccacacgacgggaa
gacaagttcatgtactttgagttccctcagccattgcctgtgtgtggtgacatcaaagta
gaattcttccacaaacagaacaagatgcttaaaaaggacaaaatgtttcatttttgggta
aatacattcttcataccaggaccagacgaaacctcagaaaaagtagaaaatggaagtcta
tgtgatcaagaaattgatagtatttgcagtatagagcgtgcagataatgacaaggaatat
ctagtactcactttaacaaaaaatgatctggacaaagcaaataaagacaaggccaatcga
tacttttctccaaattttaaggtaaagctgtacttcacaaaaacagtagaagagccatca
aatccagaggctagcagttcaacttctgtaacaccagatgttagtgacaatgaacctgat
cattatagatattctgacaccactgactctgatccagagaatgaaccttttgatgaagat
cagcatacacaaattacaaaagtctga

DBGET integrated database retrieval system