KEGG   Pteropus alecto (black flying fox): 102882358
Entry
102882358         CDS       T02993                                 

Gene name
CHEK2
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase Chk2
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04218  Cellular senescence
pale05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102882358 (CHEK2)
   04115 p53 signaling pathway
    102882358 (CHEK2)
   04218 Cellular senescence
    102882358 (CHEK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102882358 (CHEK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102882358 (CHEK2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pale03400]
    102882358 (CHEK2)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102882358 (CHEK2)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   102882358 (CHEK2)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102882358 (CHEK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like Kdo Pkinase_fungal RIO1 YrbL-PhoP_reg Haspin_kinase APH
Other DBs
NCBI-GeneID: 102882358
NCBI-ProteinID: XP_006904934
LinkDB
Position
Unknown
AA seq 563 aa
MCGSRWAHAVVMSRETDVECQQSHGSASSQSHGSSTSSQSQGGFLQSHGLSSQTQDSSQS
QGTSSSSTSTVPTSSQSSHSSSGTLSSLDTVSTQELYSIPEDQEPEEPVPAPWARLWALQ
DGFSNLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREMGPKNSYIAYI
EDHSGNGTFVNRELXXXXXXXXXXXXSEIALSVWSNKVFVFFDLTVDDQSVYPKELRDEY
IMSKTLGSGACGEVKLAFERKTCKKVAIKIISKRKFAIGSERETDPALNVETEIEILKKL
NHPCIIKIKDFFDAEDYYIVLELMEGGELFDRVVENKRLKEATCKLYFYQMLLAVQYLHE
NGIIHRDLKPENVLLSSQKEDCLIKITDFGQSKILGETSLMKTLCGTPTYLAPEVLNSFG
TAGYNRAVDCWSLGVILFICLSGYPPFSEHKTQVSLKDQITSGKYNFIPEVWAEVSEKAL
DLVKKLLIVDPKARFTTEEALGHPWLQDEDMKKKFQNLLFEENKSTTLPQVPAQPSTSRK
RLLEGELEDADTTKRLAVCAAVS
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgtgcggctccaggtgggctcacgcggtcgtaatgtctcgggagacggatgtggaatgt
cagcagtcccatggcagtgcgtcctcacaatcccatggcagcagcaccagctcgcagtcc
caaggcggcttcttgcagtcccatggcctctcctcacagacacaagactcctcacagtcc
cagggcacatccagctcctccactagcacagtgcccacatccagccagtcctctcactcc
agttcgggaacactgagctccttagacacagtgtctactcaggaactgtattctattcct
gaggaccaagaacctgaggagcctgtccctgccccttgggctcgattatgggcccttcag
gatggattctccaatcttgagtgtgttaatgacaactactggtttgggagggataaaagc
tgtgaatactgctttgatgagccactgctgaaaagaacggataaataccggacttatagt
aagaagcactttcggattttcagggaaatgggtcctaaaaactcttacatcgcatacata
gaagatcacagtgggaatggaaccttcgtaaatagagagttgnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnntctgaaattgcactttccgtatggagtaataaagtttttgta
ttttttgatctgactgtagatgatcagtcagtttatcccaaggaattaagagacgaatac
atcatgtcaaaaactcttggaagtggtgcctgtggtgaggtgaagctagcttttgagagg
aaaacatgtaagaaagtagccataaagatcatcagcaaaaggaagtttgctatcggctct
gagagagaaacagatccagctctcaacgttgaaacagaaatagaaattttgaaaaaatta
aatcatccttgtatcatcaagattaaagacttttttgatgctgaagattattatattgtt
ttggaattgatggaaggaggtgagctatttgacagggtggtggagaataaacgtctgaaa
gaagctacatgcaaactgtatttttaccagatgctcctggcagtacagtaccttcacgaa
aatggtattatacatcgagatttaaagccagagaatgttctactctcatctcaaaaagag
gactgtcttataaagattactgattttgggcagtccaagattttgggggagacctctctc
atgaaaactttatgtggtacccctacctacctggctcctgaggttcttaattcctttggg
actgctggatataatcgtgctgtggactgctggagtttaggagttattctttttatttgc
cttagtgggtatccacctttctctgagcataagactcaagtgtcactgaaggatcagatc
accagtggaaaatacaacttcattcccgaagtctgggcagaggtctcagagaaggctctg
gaccttgtcaagaagttgttgatagtggatcctaaggcgcgttttacaacagaagaagct
ttgggacacccgtggcttcaggatgaggacatgaagaaaaaattccaaaatttgcttttt
gaagaaaataagtcaacgactctaccccaggtcccagcccagccgtctacgagtcgaaag
cggctccttgaaggggaactagaggatgccgacaccacaaagcgcctagctgtatgtgct
gctgtctcgtga

KEGG   Pteropus alecto (black flying fox): 102882405
Entry
102882405         CDS       T02993                                 

Gene name
CHEK1
Definition
(RefSeq) serine/threonine-protein kinase Chk1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04218  Cellular senescence
pale05166  Human T-cell leukemia virus 1 infection
pale05170  Human immunodeficiency virus 1 infection
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102882405 (CHEK1)
   04115 p53 signaling pathway
    102882405 (CHEK1)
   04218 Cellular senescence
    102882405 (CHEK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102882405 (CHEK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102882405 (CHEK1)
   05170 Human immunodeficiency virus 1 infection
    102882405 (CHEK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102882405 (CHEK1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pale03400]
    102882405 (CHEK1)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102882405 (CHEK1)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   102882405 (CHEK1)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102882405 (CHEK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH
Other DBs
NCBI-GeneID: 102882405
NCBI-ProteinID: XP_006915268
UniProt: L5KGZ5
LinkDB
Position
Unknown
AA seq 476 aa
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRRTEEAVAVKIVDMKRAIDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEQDAQRFFHQLMAGVIY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRHNNRERLLNKMCGTLPYVAPELLK
RKEFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSVRITIPDIKKDRWYNKPLKKGAKRPRITSGGISESPSGFSKHIQSNLDF
SPVNSTSSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPACPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTVSTTDRR
NNKLIFKVNLVEMDEKILVDFRLSKGDGLEFKRHFLKIKGKLSDVVSSQKIWLPAT
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcagtgccctttgtggaagactgggacttggtgcaaaccctgggagaaggtgcctat
ggagaagttcaacttgctgtgaatagaagaactgaagaagcagttgcagtgaagattgta
gacatgaagcgtgccatagactgtccagaaaatattaagaaagagatctgtatcaataaa
atgttaaatcatgaaaatgtagtgaaattttatggtcacaggagagaaggcaatattcaa
tacctatttctggagtattgtagtgggggagaactttttgaccgaatagagccagacata
ggcatgcctgaacaagatgctcagaggttcttccatcaactcatggcaggggtgatttat
ctgcatggtattggaataactcacagggatattaagccagaaaatctcctgttggatgaa
agggataacctcaaaatctctgactttggcttggcaacagtgtttcggcataataatcgt
gagcgtttattgaacaagatgtgtggtactttaccttatgttgctccagaacttctaaag
aggaaagaatttcatgcagaaccagttgatgtttggtcctgtggaatagtacttactgca
atgttggctggagaattgccatgggaccagcccagtgacagttgtcaggagtattccgat
tggaaagaaaaaaaaacatacctcaacccttggaaaaaaattgattctgctcctctagct
ctgttgcataaaatcctagttgagaatccatcagtaaggattaccatcccagatatcaaa
aaagatagatggtacaacaaaccactcaagaaaggggcaaagcggccccgaatcacttca
ggtggtatatcagagtcacctagtggattctctaaacacattcaatccaatttggacttc
tctccagtaaacagtacttctagtgaagaaaatgtgaagtactccagttcccagccagaa
ccacggacaggtctgtccttatgggacaccagcccttcatatattgataaactggtacaa
gggatcagtttttctcagcccgcatgtccagatcatatgcttctgaatagtcagttactt
ggcaccccgggatcctcacagaacccctggcagcgcttggtcaaaagaatgacacgattt
tttaccaaattggatgcagataaatcttatcaatgcctgaaagagacttgcgagaaattg
ggatatcaatggaagaagagttgtatgaatcaggttactgtatcaacaactgatagaaga
aacaataaactgatttttaaagtaaatttagtagaaatggatgagaagatcttggttgat
ttccggctttctaagggtgatggattagaattcaagagacacttcctgaagattaaaggg
aagctgagtgatgttgtaagcagccagaagatttggcttcctgccacatga

DBGET integrated database retrieval system