KEGG   Pteropus alecto (black flying fox): 102882441
Entry
102882441         CDS       T02993                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X4
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04012  ErbB signaling pathway
pale04062  Chemokine signaling pathway
pale04110  Cell cycle
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04310  Wnt signaling pathway
pale04340  Hedgehog signaling pathway
pale04360  Axon guidance
pale04390  Hippo signaling pathway
pale04510  Focal adhesion
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04657  IL-17 signaling pathway
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04722  Neurotrophin signaling pathway
pale04728  Dopaminergic synapse
pale04910  Insulin signaling pathway
pale04916  Melanogenesis
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale05010  Alzheimer disease
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05135  Yersinia infection
pale05160  Hepatitis C
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05213  Endometrial cancer
pale05215  Prostate cancer
pale05217  Basal cell carcinoma
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102882441 (GSK3B)
   04310 Wnt signaling pathway
    102882441 (GSK3B)
   04340 Hedgehog signaling pathway
    102882441 (GSK3B)
   04390 Hippo signaling pathway
    102882441 (GSK3B)
   04151 PI3K-Akt signaling pathway
    102882441 (GSK3B)
   04150 mTOR signaling pathway
    102882441 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102882441 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102882441 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    102882441 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102882441 (GSK3B)
   04657 IL-17 signaling pathway
    102882441 (GSK3B)
   04662 B cell receptor signaling pathway
    102882441 (GSK3B)
   04062 Chemokine signaling pathway
    102882441 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102882441 (GSK3B)
   04917 Prolactin signaling pathway
    102882441 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    102882441 (GSK3B)
   04919 Thyroid hormone signaling pathway
    102882441 (GSK3B)
   04916 Melanogenesis
    102882441 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102882441 (GSK3B)
   04722 Neurotrophin signaling pathway
    102882441 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    102882441 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102882441 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102882441 (GSK3B)
   05225 Hepatocellular carcinoma
    102882441 (GSK3B)
   05226 Gastric cancer
    102882441 (GSK3B)
   05217 Basal cell carcinoma
    102882441 (GSK3B)
   05215 Prostate cancer
    102882441 (GSK3B)
   05213 Endometrial cancer
    102882441 (GSK3B)
   05224 Breast cancer
    102882441 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102882441 (GSK3B)
   05020 Prion disease
    102882441 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    102882441 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102882441 (GSK3B)
   04931 Insulin resistance
    102882441 (GSK3B)
   04934 Cushing syndrome
    102882441 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102882441 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102882441 (GSK3B)
   05162 Measles
    102882441 (GSK3B)
   05163 Human cytomegalovirus infection
    102882441 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102882441 (GSK3B)
   05165 Human papillomavirus infection
    102882441 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102882441 (GSK3B)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     102882441 (GSK3B)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   102882441 (GSK3B)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102882441 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 102882441
NCBI-ProteinID: XP_006905602
LinkDB
Position
Unknown
AA seq 420 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANAGDRGQTNNAASASASNST
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtcagggcgacccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggaagtaaggtgactacagtg
gtggcaactcctgggcagggcccagacaggccacaagaagtcagctatacagacactaaa
gtaattggaaatgggtcatttggtgtggtatatcaagctaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattacaggacaagagatttaagaaccgagagctccaaatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gagaagaaagatgaggtctatcttaatctggtgctggattatgtcccggaaacagtatac
agagtcgccagacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcagctgtttcgaagtttagcctatattcattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggaccccgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgcgggctgtgtgctggctgagctgttattaggacaaccaatatttccaggggac
agtggtgtggatcagttggtggaaataatcaaggtcctggggacaccaacaagggagcaa
attagagaaatgaacccaaactatacagaattcaaatttcctcaaattaaggcccatcct
tggactaaggtcttccgaccccgaactccaccagaggcaattgcactgtgtagccgtctg
ctggagtatacaccaactgccagactgacacccctggaagcttgtgcacattcatttttt
gatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacccgcactcttc
aacttcaccactcaagaactgtcaagtaatccacctctagctactattcttattcctcct
catgctcggattcaagcagctgcttcaactcctacaaatgccacagcagcctcagatgct
aatgctggagaccgtggacagaccaataatgccgcttctgcatcagcttccaactccacc
tga

DBGET integrated database retrieval system