KEGG   Pteropus alecto (black flying fox): 102882462
Entry
102882462         CDS       T02993                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04062  Chemokine signaling pathway
pale04068  FoxO signaling pathway
pale04072  Phospholipase D signaling pathway
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04510  Focal adhesion
pale04540  Gap junction
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04714  Thermogenesis
pale04722  Neurotrophin signaling pathway
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04912  GnRH signaling pathway
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04926  Relaxin signaling pathway
pale04935  Growth hormone synthesis, secretion and action
pale05034  Alcoholism
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102882462 (SOS1)
   04012 ErbB signaling pathway
    102882462 (SOS1)
   04014 Ras signaling pathway
    102882462 (SOS1)
   04630 JAK-STAT signaling pathway
    102882462 (SOS1)
   04068 FoxO signaling pathway
    102882462 (SOS1)
   04072 Phospholipase D signaling pathway
    102882462 (SOS1)
   04151 PI3K-Akt signaling pathway
    102882462 (SOS1)
   04150 mTOR signaling pathway
    102882462 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102882462 (SOS1)
   04540 Gap junction
    102882462 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102882462 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102882462 (SOS1)
   04660 T cell receptor signaling pathway
    102882462 (SOS1)
   04662 B cell receptor signaling pathway
    102882462 (SOS1)
   04664 Fc epsilon RI signaling pathway
    102882462 (SOS1)
   04062 Chemokine signaling pathway
    102882462 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102882462 (SOS1)
   04912 GnRH signaling pathway
    102882462 (SOS1)
   04915 Estrogen signaling pathway
    102882462 (SOS1)
   04917 Prolactin signaling pathway
    102882462 (SOS1)
   04926 Relaxin signaling pathway
    102882462 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    102882462 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102882462 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102882462 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102882462 (SOS1)
   05206 MicroRNAs in cancer
    102882462 (SOS1)
   05205 Proteoglycans in cancer
    102882462 (SOS1)
   05231 Choline metabolism in cancer
    102882462 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102882462 (SOS1)
   05225 Hepatocellular carcinoma
    102882462 (SOS1)
   05226 Gastric cancer
    102882462 (SOS1)
   05214 Glioma
    102882462 (SOS1)
   05221 Acute myeloid leukemia
    102882462 (SOS1)
   05220 Chronic myeloid leukemia
    102882462 (SOS1)
   05211 Renal cell carcinoma
    102882462 (SOS1)
   05215 Prostate cancer
    102882462 (SOS1)
   05213 Endometrial cancer
    102882462 (SOS1)
   05224 Breast cancer
    102882462 (SOS1)
   05223 Non-small cell lung cancer
    102882462 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    102882462 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102882462 (SOS1)
   05160 Hepatitis C
    102882462 (SOS1)
   05163 Human cytomegalovirus infection
    102882462 (SOS1)
   05165 Human papillomavirus infection
    102882462 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102882462 (SOS1)
   01522 Endocrine resistance
    102882462 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pale04990]
    102882462 (SOS1)
Domain-containing proteins not elsewhere classified [BR:pale04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102882462 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 102882462
NCBI-ProteinID: XP_006909715
LinkDB
Position
Unknown
AA seq 1276 aa
MLCQAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEV
LGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITEQDIKVAMCADKVLMDMFH
QDVEDINILSLTDEEPSTSGEQTYYDLVKSFMAEIRQYIRELNLIIKVFREPFVSNSKLF
STNDVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYES
YARDILRPGFHDHFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELL
KQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQL
AIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQ
PRLPGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNW
MAALISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAG
IPIIKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTE
ADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEF
IGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLL
TLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEK
CIVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQ
KKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELIN
FSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIE
PRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTA
SAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPLHSSSDTVFTQLTLSHGPRSASVSS
ISLTKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYS
ISDRTSVSDAPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFT
PPPPQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHP
SMHRDGPPLLENAHSS
NT seq 3831 nt   +upstreamnt  +downstreamnt
atgctatgccaagctcagccccgaagtgcttccgatgtagaggaacgagttcaaaaaagt
tttcctcatccaattgataagtgggcaatagctgatgcccaatcggctattgaaaagagg
aaacgaagaaatcctttatctctcccagtagaaaaaattcatcctttattaaaggaggtc
ctaggttataaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatt
tctgcagacattttaaagctggtggggaattatgtacgaaatatacggcattatgaaatt
acagaacaagatattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcat
caagatgtagaagatataaatatattatctttaactgatgaagagccttccacctcagga
gagcaaacttactatgatttggtaaaatcatttatggcagaaattcgacaatacataagg
gaactaaatttaattataaaagtttttagagagccttttgtctccaattcaaaattgttt
tcaactaacgatgtagaaaatatatttagtcgtatagtagatatacatgaacttagtgta
aagttactgggccatatagaagatactgtagaaatgactgatgaaggcagtccccatcca
ttagtaggaagctgctttgaagacttagcagaggaactggcatttgatccatatgaatca
tatgctcgagatattttacgacctggttttcacgatcattttcttagtcagttatcaaag
cctggagcagcactttatttacagtcaataggcgaaggtttcaaggaagctgttcaatat
gttttacccaggctgcttctagccccggtttaccactgtctacattactttgaacttttg
aagcagttagaagaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagcaata
acagctttgcttaatgttcaaagtggtatggaaaaaatatgttcaaaaagtcttgcaaaa
cgaagactgagtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaacta
gcaatcaagaaaatgaatgagattcagaagaatattgatggttgggagggaaaagacatt
ggacagtgttgcaatgaatttataatggaaggaactcttacacgtgtaggagccaaacat
gagagacacatatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcag
ccaagacttcctggtgctagtaatgcagaatatcgtcttaaagaaaagttttttatgaga
aaggtacaaattaatgacaaagatgacaccagtgagtacaagcatgcttttgaaataatt
ttaaaagatgaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaattgg
atggcagcattgatatctttacagtaccgaagtacactggaaaggatgcttgatgtgaca
atgctacaggaagagaaggaggagcagatgaggctccctagtgctgatgtttatagattt
gcagagcctgactctgaagagaacataatatttgaagaaaacatgcagcccaaggctgga
attccaattatcaaagcaggaactgttattaaactgatagagaggctcacataccatatg
tacgcagatcccaattttgttcggacatttcttacaacatacagatccttttgtaaacct
caagaactactgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaa
gctgatcgcattgctatagagaatggagatcaacccttgagtgcagaactaaaaagattt
agaaaagaatatatacagcctgtacaactgcgcgtattaaatgtatgtcggcactgggtt
gagcatcacttctatgattttgaaagagatgcagatcttttgcagcgaatggaggaattt
attgggacagtaagaggtaaagcaatgaaaaaatgggtcgaatccatcactaaaataatc
caaaggaaaaaaattgcaagagacaatggaccaggtcataatattacatttcagagttca
cctcccacagttgagtggcatataagcagacctgggcacatagagacttttgacctgctc
accttacacccgatagaaattgctcgacaactcactttacttgaatcagatctatatcga
gctgtacagccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaat
tctcctaatcttctgaaaatgatccggcacaccactaatctcactctgtggtttgagaaa
tgtattgtagaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgaa
attctgcaagtctttcaagagctgaacaacttcaatggtgtcctcgaggttgtcagtgct
atgaactcatcacctgtttacaggctagaccacacgtttgagcaaataccaagtcgtcaa
aagaaaattttagaagaagctcacgaattaagcgaagatcactataagaaatatttggca
aaactcaggtctattaatccaccatgtgtgcctttctttggaatttatctaactaatatc
ttgaaaacagaagaaggcaaccctgaggttctaaaaaggcatggaaaagagcttataaac
tttagtaaaaggaggaaagtagcagaaataacaggagagatccagcagtaccaaaatcag
ccttattgtttacgagtggaatcagatatcaaaaggttctttgaaaacttgaatccaatg
ggaaatagcatggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaa
ccacgaaaccctaagcctctcccaagatttccaaaaaaatatagctatcccttaaaatct
cctggtgttcgtccatcaaacccaagaccaggtaccatgagacatcccacacctctgcag
caggagccaaggaaaattagttacagtcggatccctgaaagtgagacagaaagtacagcg
tctgcaccaaattctccaagaacaccgttaacacctcctcctgcttctggtgcttctagt
accacagatgtttgcagcgtatttgattctgatcattcgagccctcttcactcaagcagc
gataccgtctttacccaacttacactgtcccatggcccaagatctgcttcagtatcatct
ataagtttaaccaagggcactgatgaagtgcctgtcccccctcctgttcctccacgaaga
cgaccagaatctgccccagcggaatcgtcgccatctaagattatgtctaagcatttggac
agccccccagcaattcctcctaggcaacccacatcaaaagcttattcaccacgatactca
atatcagaccggacttctgtatcagacgctcctgaaagccctcccttgttaccaccacga
gaacctgtgaggacacctgatgttttctcaagctcaccactacatctccaacctccccct
ttgggcaaaaaaagtgatcatggcaatgccttcttcccaaacagcccttcccccttcacg
ccacctcctcctcaaacaccttctcctcatggcacgagaaggcatctgccatcaccaccg
ttgacacaagaagtggaccttcattccattgctgggccacctgttcctccacgacaaagc
acttctcaacatattcctaaactccctccaaaaacttacaaaagggagcacacacaccca
tccatgcacagagatggaccaccactgttggagaatgcccattcttcctga

KEGG   Pteropus alecto (black flying fox): 102889597
Entry
102889597         CDS       T02993                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04062  Chemokine signaling pathway
pale04068  FoxO signaling pathway
pale04072  Phospholipase D signaling pathway
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04510  Focal adhesion
pale04540  Gap junction
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04714  Thermogenesis
pale04722  Neurotrophin signaling pathway
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04912  GnRH signaling pathway
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04926  Relaxin signaling pathway
pale04935  Growth hormone synthesis, secretion and action
pale05034  Alcoholism
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102889597 (SOS2)
   04012 ErbB signaling pathway
    102889597 (SOS2)
   04014 Ras signaling pathway
    102889597 (SOS2)
   04630 JAK-STAT signaling pathway
    102889597 (SOS2)
   04068 FoxO signaling pathway
    102889597 (SOS2)
   04072 Phospholipase D signaling pathway
    102889597 (SOS2)
   04151 PI3K-Akt signaling pathway
    102889597 (SOS2)
   04150 mTOR signaling pathway
    102889597 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102889597 (SOS2)
   04540 Gap junction
    102889597 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102889597 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102889597 (SOS2)
   04660 T cell receptor signaling pathway
    102889597 (SOS2)
   04662 B cell receptor signaling pathway
    102889597 (SOS2)
   04664 Fc epsilon RI signaling pathway
    102889597 (SOS2)
   04062 Chemokine signaling pathway
    102889597 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102889597 (SOS2)
   04912 GnRH signaling pathway
    102889597 (SOS2)
   04915 Estrogen signaling pathway
    102889597 (SOS2)
   04917 Prolactin signaling pathway
    102889597 (SOS2)
   04926 Relaxin signaling pathway
    102889597 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    102889597 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102889597 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102889597 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102889597 (SOS2)
   05206 MicroRNAs in cancer
    102889597 (SOS2)
   05205 Proteoglycans in cancer
    102889597 (SOS2)
   05231 Choline metabolism in cancer
    102889597 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102889597 (SOS2)
   05225 Hepatocellular carcinoma
    102889597 (SOS2)
   05226 Gastric cancer
    102889597 (SOS2)
   05214 Glioma
    102889597 (SOS2)
   05221 Acute myeloid leukemia
    102889597 (SOS2)
   05220 Chronic myeloid leukemia
    102889597 (SOS2)
   05211 Renal cell carcinoma
    102889597 (SOS2)
   05215 Prostate cancer
    102889597 (SOS2)
   05213 Endometrial cancer
    102889597 (SOS2)
   05224 Breast cancer
    102889597 (SOS2)
   05223 Non-small cell lung cancer
    102889597 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    102889597 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102889597 (SOS2)
   05160 Hepatitis C
    102889597 (SOS2)
   05163 Human cytomegalovirus infection
    102889597 (SOS2)
   05165 Human papillomavirus infection
    102889597 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102889597 (SOS2)
   01522 Endocrine resistance
    102889597 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pale04990]
    102889597 (SOS2)
Domain-containing proteins not elsewhere classified [BR:pale04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102889597 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH Histone IQ_SEC7_PH PH_19 PH_13 PH_10
Other DBs
NCBI-GeneID: 102889597
NCBI-ProteinID: XP_006920269
LinkDB
Position
Unknown
AA seq 1272 aa
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPTSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDKKLFKPSDI
EKIFSNISDIHELTIKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCEYKHAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
VEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPAPTGAFDGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHLHKDPDWFRDVSTCPNSPN
TPPSTPSPRVPRRCYVLNSSQNNLAHPQAPPVPPRQTSSPHLPKLPPKTYKRELSHPPLY
RLPLLENAETPQ
NT seq 3819 nt   +upstreamnt  +downstreamnt
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaaaacctttcctcat
ccaattgataaatgggctattgctgatgcacagtctgccatagagaaacgaaaacgaaga
aatcctctcttgctgcctgtggacaaaatccatccttcactgaaggaagttttagggtac
aaagtggactaccatgtgtctttatatattgtggctgtactagagtatatctcagctgat
attttgaaattggctggtaattatgtttttaatattcgacattatgaaatatctcagcag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggtttggtttctctttgtgaagatgaacctacttcttcaggtgaattaaactactat
gatcttgtcagaactgaaattgcagaagaaagacagtatttacgggaactaaatatgatc
ataaaagtttttcgagaagcctttctttctgacaaaaagctgtttaaaccttctgacatt
gaaaagattttcagtaatatttcagatatacatgagttgactataaaacttttaggtttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatcctttagctggcagctgt
tttgaagatttggcagaagagcaagcatttgatccttatgaaacattatcacaggacatt
ctttcacctaaattcaatgaacatttcagtaagttgatggccagacctgcagtggctctt
cactttcagtccattgctgatggttttaaagaagcagttcgttatgtccttccacgcctt
atgctggtgccagtgtatcactgttggcactattttgaattattgaagcaattgaaagca
tgtagtgaagaacaagaagacagagaatgtttgaaccaagctattactgctctcatgaat
ctccaaggtagtatggaccgaatttacaagcagtattcaccccgacgccgacctggggat
cctgtttgccctttttataatcgccaattaagaagcaagcatctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacagtgttgtaat
gaatttattatggaaggtccattgacaagaattggtgctaaacatgaacggcatattttt
ctctttgatggcttaatgattagctgcaaacccaatcatagccagtcacgccttccaggt
tacagtagtgcagaatacagattaaaagaaaaatttgtcatgagaaaaatacaaatatgt
gataaagaagatacttgtgagtacaaacatgcttttgagttagtatccaaagatgaaaac
agtataatatttgcagctaagtccgctgaagagaaaaacaattggatggcagcacttatt
tctcttcattatcgtagtactctagatcgaatgctagattcagtattattgaaagaagaa
aatgaacaaccattgagattaccaagtcctgaagtatatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacttgcaaagtagaagtggaatccccattattaaa
ggaggaactgtggtgaaattaattgaaaggttaacatatcatatgtatgcagatcccaat
tttgttcgtacttttcttactacatatcgttcattttgtaaaccacaggaattgctaagc
ttactaattgaacgatttgaaattccagagccagaacctactgaagccgataaattggca
gtagagaaaggcgagcagccaattagtgcagaccttaaaaggtttcgcaaggaatacgtc
caaccagtacaacttagaatcttaaatgtttttcggcactgggttgaacaccatttttat
gactttgaaagagatttggagttgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagccatgaagaaatgggtagaatcaattgctaagatcatcaagaggaagaaacaa
gctcaggcaaatggaataagccacaatattacctttgaaagtccacctccaccaattgaa
tggcatatcagcagaccaggacagtttgaaacatttgatctcatgacacttcatccaata
gaaattgcacgtcaactgacacttttggaatctgatctttacaggaaagtacaaccttct
gaacttgtaggaagtgtatggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccacactacaaatcttacgctctggtttgaaaagtgcattgtggaagca
gaaaattttgaggaacgagtggcagtactgagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggtgtattggagatagtcagtgcagtaaattcagtgtca
gtatacagactagaccatacctttgaggcattgcaggaaagaaaaaggagaattttggat
gaagctgtggaattgagtcaagaccactttaaaaaatacctagtaaaacttaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaagaa
gggaataatgattttttaaaaaagaaagggaaagacttaatcaatttcagtaagaggagg
aaagtggctgaaattactggagaaattcagcagtatcagaatcaaccttattgtttacgg
atagaaccagaaatgaggcgattctttgaaaatcttaaccccatgggaagtgcttctgaa
aaagagtttacagattatttgttcaacaagtcactagaaattgaaccccgaaactgcaaa
cagccacctcgatttcctaggaaatcaactttctctttgaaatctcctggaataaggcct
aatacaggccgacatggctctacctcaggcactttacgaggtcatccaacaccattggaa
agagaaccatgtaaaataagctttagtcggattgctgaaactgagcttgagtcaacagtg
tcagcaccaacctctccaaacacaccatctactccgccagtatctgcttcttcagacctc
agtgtgtttttagatgtggatctcaatagttcctgtggcagcaatagcatctttgctcca
gttctcttgccacattcaaagtctttcttcagttcgtgtggtagtttacataaacttagt
gaagagccactgattcctcctcctcttcctcctcgaaaaaagtttgatcatgatgcttca
aattccaagggaaatatgaaatctgatgatgacccccctgctattccaccgagacaacct
cctcctccaaaggtaaaacccagagttcctgctcctactggtgcatttgatgggcctctg
catagtccacctccaccgccaccgagagatcctcttcctgatacccctccaccggttccc
cttcggcctccagaacactttataaactgtccatttaatcttcagccacctccgctggga
catcttcacaaagatccagactggttcagagatgttagtacgtgtcctaattcgccaaac
actcctcctagcacaccctctccaagggtgccacgtcgatgctatgtgctcaattctagt
cagaataatcttgctcatcctcaagctccccctgttccaccaaggcagacttcaagccct
cacctcccaaaactgccaccaaagacttacaaacgggagctttcacatcccccattgtac
agactgcctttgctagaaaatgcagaaactcctcaatga

DBGET integrated database retrieval system