KEGG   Pteropus alecto (black flying fox): 102882682
Entry
102882682         CDS       T02993                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X2
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04260  Cardiac muscle contraction
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04713  Circadian entrainment
pale04720  Long-term potentiation
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04727  GABAergic synapse
pale04728  Dopaminergic synapse
pale04742  Taste transduction
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04921  Oxytocin signaling pathway
pale04924  Renin secretion
pale04925  Aldosterone synthesis and secretion
pale04927  Cortisol synthesis and secretion
pale04929  GnRH secretion
pale04930  Type II diabetes mellitus
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale05010  Alzheimer disease
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05031  Amphetamine addiction
pale05410  Hypertrophic cardiomyopathy
pale05412  Arrhythmogenic right ventricular cardiomyopathy
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102882682 (CACNA1C)
   04020 Calcium signaling pathway
    102882682 (CACNA1C)
   04024 cAMP signaling pathway
    102882682 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    102882682 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102882682 (CACNA1C)
   04929 GnRH secretion
    102882682 (CACNA1C)
   04912 GnRH signaling pathway
    102882682 (CACNA1C)
   04921 Oxytocin signaling pathway
    102882682 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    102882682 (CACNA1C)
   04924 Renin secretion
    102882682 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    102882682 (CACNA1C)
   04927 Cortisol synthesis and secretion
    102882682 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102882682 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102882682 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102882682 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    102882682 (CACNA1C)
   04727 GABAergic synapse
    102882682 (CACNA1C)
   04725 Cholinergic synapse
    102882682 (CACNA1C)
   04728 Dopaminergic synapse
    102882682 (CACNA1C)
   04726 Serotonergic synapse
    102882682 (CACNA1C)
   04720 Long-term potentiation
    102882682 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    102882682 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    102882682 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102882682 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102882682 (CACNA1C)
   05020 Prion disease
    102882682 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    102882682 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    102882682 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102882682 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102882682 (CACNA1C)
   05414 Dilated cardiomyopathy
    102882682 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102882682 (CACNA1C)
   04934 Cushing syndrome
    102882682 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pale04040]
    102882682 (CACNA1C)
Ion channels [BR:pale04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102882682 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel DUF4834
Other DBs
NCBI-GeneID: 102882682
NCBI-ProteinID: XP_006923952
LinkDB
Position
Unknown
AA seq 2191 aa
MVNENTRMYIPEENHQGSSYGSPRSAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKYPLPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLK
VIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKT
CYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVF
QCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKA
RGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTE
NVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLN
TLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKVYSLGLQAYFVSLFNRFDCFVVC
GGILETILVETKVMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLL
LFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIM
AYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKK
LARTASPEKKQEVIEKPAVEETKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSAY
PNPETTGEEDDEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIV
NDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNAD
YVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKIL
RVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYT
CSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGW
PELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEY
KNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLA
MQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIID
VILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFR
LFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALND
TTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGS
SFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAK
GRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTA
LRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR
KFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSA
ASEDDIFRRAGGLFGNHVVSYYQSDGRSAFPQTFTAQRPLHINKAGNSQGDTESPSHEKL
VDSTFTPSSYSSTGSNANINNANNTALTRSPRPVGSPSAAGTTEGHGPPSSPAVRVQEAA
WKLSSKRCHSRESQIAMVCQEVSQEETYDVKMSDDAEYCSEPSLIATEMLSYQDDENRQL
TPPEEDKRDIRQSPKRGFLRSSSLGRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQA
LAVAGLSPLLQRSHSPTTFRRPCATPPDTPGSRGWPPKPIPTLRLEGADSSENLNSSFPS
IHCSSWSGEPTPCGGASSATRKARPVSLTVPSQARAWGRQFHGSASSLVEAVLISEGLGQ
FAQDPKFIEVTTQELADACDMTIEEMENAADNILSGGTQQSPNGTLLPFVNCRDPGQDRA
GVEEDEPCGPPQECRRGEEELQDSRAYVSGL
NT seq 6576 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacacgaggatgtacatcccagaggaaaaccaccaaggttccagctat
gggagcccacgctcagctcatgccaacatgaatgccaatgcagcggcagggcttgccccc
gagcacatccctactccaggggcggccctgtcctggcaggcagccatcgatgcggcccgg
caggccaagctgatgggaagtgctggcaatgcgaccatctccactgtcagctccacacag
cggaagcggcagcagtacgggaaacccaagaagcagggcagcacgaccgccacacgcccg
cctcgcgccctgctctgcctgactctgaagaaccccatccgcagggcgtgcataagcatt
gtcgaatggaaatatcctttaccatttgaaatcattattttactgactatttttgccaat
tgtgtggccttagcgatctatattccctttccagaagatgactccaatgccaccaattcc
aacctggaacgagtggaatatctctttctcatcatttttactgtggaagcatttttaaaa
gtaatagcctatggacttctctttcaccccaacgcttacctccgcaatggctggaattta
ctagattttataattgtggttgtagggctttttagtgcaattttagaacaagcaaccaaa
gctgatggggccaatgctctaggagggaaaggggctggatttgatgtgaaggctctgagg
gcgtttcgcgtgctgcgccccttgcggctggtgtccggagtcccgagtctccaggtggtc
ctgaattccatcatcaaggccatggtccccctgctgcatatcgccctgctagtgctgttt
gtcatcatcatctatgctatcatcggcctagagctcttcatggggaagatgcataagacc
tgctacaatcaggagggtatagcagatgttccagcagaagatgatccttccccttgtgct
ctggaaacgggccacgggcggcagtgccagaatggtactgtgtgcaagcccgggtgggat
gggcccaagcacggcatcaccaacttcgacaactttgccttcgccatgttgacagtgttc
cagtgcatcaccatggagggctggacagacgtgctgtactgggtcaatgatgccgtagga
agggactggccctggatctattttgttacacttatcatcatagggtcattttttgtactt
aacttggttctcggtgtccttagcggagagttttctaaagagagagagaaggccaaggct
cggggagatttccaaaagctgagagagaagcagcagctggaagaggatctgaaaggctac
ctggactggatcacccaagcagaagacatcgaccctgagaacgaggatgaaggcatggat
gaggagaaaccccgaaacatgagcatgcccacaagtgagacggagtctgtcaacactgag
aacgtggctggaggtgacatcgagggagaaaactgtggggccaggctggcccaccggatc
tccaagtcgaagttcagccgctactggcgccggtggaatcggttctgcagaagaaagtgt
cgcgccgcagtcaagtccaatgttttctattggctcgtgattttcctggtgttcctcaac
acgctcaccatcgcctcagagcattacaaccagcctcactggctcacagaagtccaagac
acagccaacaaggcactactggcccttttcacggcagagatgctgctgaaggtgtacagc
ctgggcttgcaggcctacttcgtgtccctgttcaaccgctttgactgcttcgtggtgtgc
gggggcatcctggagaccatcctggtggagaccaaggtcatgtctcccctgggcatctcc
gtgctcagatgcgtccgactactgaggatatttaaaatcacaaggtactggaactcctta
agcaacctggtggcatccttgctgaactccgtgcgctccatcgcctccctgctgctgctt
ctcttcctcttcatcatcatcttctccctcctgggaatgcagctctttggaggaaagttc
aactttgatgagatgcagacccggaggagtacatttgataactttccccagtccctcctc
actgtgtttcagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatg
gcttatggcggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttc
atctgtggaaactatatcctactgaatgtgttcttggccattgctgtggacaacctggct
gatgctgagagcctcacatctgcccaaaaggaggaagaagaagagaaggagaggaagaag
cttgccaggactgccagcccagagaagaaacaagaggtgatagagaagccggcagtggag
gagaccaaggaggagaaaattgagctgaaatccattacagccgatggagagtccccaccc
accaccaagatcaacatggatgacctccagcccaatgaaaatgaggataagagtgcctac
cccaacccagaaactacaggagaagaggatgatgaggagcccgagatgcctgtgggcccc
cgcccacgaccactatctgagctgcaccttaaggaaaaagcagtgcccatgccagaagcc
agtgcatttttcatcttcagccccaacaacaggttccgcctccagtgccaccgcattgtc
aatgacacaatcttcaccaacctgatcctcttcttcattctgctcagcagcatttcgctg
gccgctgaggaccctgtccagcacacgtccttcaggaaccatattctgttttattttgat
attgtttttactaccattttcaccattgaaattgctctgaagatcctaggcaatgcagac
tatgtcttcactagtatctttacattagaaattatccttaagatgactgcttatggggct
ttcttgcacaagggctccttttgccggaactacttcaacatcttggacctgctggtggtc
agcgtgtccctcatctcctttggcatccagtccagtgcaatcaatgttgtaaagatcttg
cgagttctgagagtactcaggcccttgagggccatcaacagagccaagggactgaagcac
gtggttcagtgtgtgttcgtcgccatccgaacgatcgggaacatcgtgattgtcaccaca
ctgcttcagttcatgttcgcctgcatcggggtccaactctttaagggaaagctctacacc
tgttcagacagttccaagcagacagaggcagaatgcaagggtaactacatcacgtacaag
gacggggaggttgaccaccccatcatccagcctcgcagctgggagaacagcaagttcgac
tttgacaatgttctggcagccatgatggccctcttcactgtctccacctttgaggggtgg
ccagagctgctgtaccgctccatcgactcccacacggaggacaagggccccatctacaac
taccgggtggagatctccatcttcttcatcatctacatcatcatcattgccttcttcatg
atgaacatcttcgtgggtttcgtcatcgtcaccttccaggagcagggagagcaggagtac
aagaactgtgagctggacaagaaccagcgacagtgcgtggaatacgccctcaaggcccgg
cccctgcggaggtacatacccaagaaccagcaccagtacaaagtgtggtatgtggtcaac
tccacctactttgagtacctgatgttcgtcctcatcctgctcaacaccatctgcttggcc
atgcagcactacggtcagagctgcctgttcaaaatcgccatgaatatcctcaacatgctc
ttcactggcctcttcactgtggagatgattctgaagctcattgccttcaaacccaagggt
tactttagtgatccctggaatgtttttgacttcctcatcgtaattggcagcataattgac
gtcattctcagtgaaactaatcactatttctgtgatgcatggaatacatttgacgccttg
attgttgtgggtagcattgttgatatagcaatcaccgaggtaaacccagctgaacacacc
caatgctctccctttatgaacgcagaggagaactcccgcatctccatcactttcttccgc
ctcttccgggtcatgcgcctggtcaagctgctgagccgcggggagggcatccggaccttg
ctgtggaccttcatcaagtccttccaggccctgccctacgtggcccttctgatagtgatg
ctcttcttcatttacgccgtgatcgggatgcaggtgtttgggaaaattgccctgaatgac
accacagagatcaaccgtaataacaactttcagaccttcccccaagctgtgctgcttctc
ttcaggtgtgccaccggggaggcgtggcaggacatcatgttggcctgcatgccagggaag
aagtgtgccccagagtcggagcccagcaacagcacagaaggggagacaccctgtggcagc
agcttcgccgtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaac
ctctttgtagctgtcatcatggacaactttgactacctgacaagggactggtcaatcctt
ggtccccaccatctggatgaatttaaaagaatctgggcagagtatgaccctgaagccaag
ggtcgtatcaaacacctagacgtggtgaccctgctccggcggattcagcccccattgggt
tttgggaagctgtgccctcaccgcgtggcttgcaaacgcctggtctccatgaacatgcct
ctgaacagcgatgggacagtcatgttcaatgccaccctgtttgccctggtccggacagcc
ctaaggatcaaaacagaagggaacctggaacaagccaacgaggagttgcgagccataatc
aagaagatctggaagcggaccagcatgaagctgctggaccaggtggtgccccccgcaggc
gatgatgaggtcacggttggcaagttttatgctactttcctgatccaagagtacttccgg
aaattcaagaagcgcaaagaacagggcctcgtgggcaagccctcccagaggaatgccttg
tccctgcaggctggcttgcgcactctacatgacatcgggcccgagattcgacgagccatc
tctggagacctgacagctgaggaggagctggacaaagccatgaaggaggctgtgtctgct
gcctccgaagatgacatcttcaggagggccggtggcctgtttggcaaccacgtcgtcagc
tactaccaaagcgacggccggagcgccttcccccagaccttcaccgcccagcgcccgctg
cacatcaacaaggcgggtaacagccaaggcgacaccgagtcgccatcccacgagaaactg
gtggactccaccttcacccccagcagctactcatccactggctccaacgccaacatcaac
aacgccaacaacaccgccctgacccgctcccctcgccccgtcggctcccccagcgcagcc
ggcactacggagggccacgggcccccctcgtctcctgctgtccgggtgcaggaggcagcg
tggaagctcagctccaagaggtgccactcccgggagagccagatagccatggtgtgtcag
gaggtctcccaggaagagacgtacgatgtgaagatgagtgacgatgccgagtactgcagc
gagcccagcctgatcgccacagagatgctctcctatcaggatgatgaaaaccgacagttg
acaccccctgaggaggacaagagggacatccggcaatctccaaagaggggtttcctccgc
tcgtcctccctaggtcgaagggcctccttccatctggaatgtctgaagcgacagaagaac
caagggggagacatctctcagaagacagttctgcccttgcatctggtccatcatcaggcg
ttggccgtggcaggcctgagcccactcctccagagaagccattcccccaccacgttccgc
agaccatgtgccacccctccagacacgcccggcagccgaggctggcccccaaagcccatc
cccaccctgcggctggaaggagccgactccagcgagaatctcaacagcagcttcccatcc
atccactgcagctcctggtctggggagcccacgccctgtgggggggccagcagtgccacc
cggaaagcccggcctgtgtccctcactgtgcccagccaggccagagcctggggcaggcag
ttccatggcagtgccagcagtctggtagaagcggtcttgatttcagaaggactggggcag
tttgctcaagatcccaaattcatcgaagtcacaacccaggagctagctgatgcctgcgac
atgaccatagaggagatggagaatgctgctgacaacatcctcagtgggggcacccagcag
agccccaacggcaccctattaccttttgttaactgcagggacccagggcaggacagagca
ggggtagaagaggacgagccctgtgggcccccgcaggagtgtcgaaggggcgaggaggag
ctgcaggacagccgagcctacgtcagcggcctgtag

DBGET integrated database retrieval system