KEGG   Pteropus alecto (black flying fox): 102882717
Entry
102882717         CDS       T02993                                 

Gene name
BUB3
Definition
(RefSeq) mitotic checkpoint protein BUB3
  KO
K02180  cell cycle arrest protein BUB3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102882717 (BUB3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102882717 (BUB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pale03041]
    102882717 (BUB3)
   03036 Chromosome and associated proteins [BR:pale03036]
    102882717 (BUB3)
Spliceosome [BR:pale03041]
 Complex A
  Other components
   Complex A specific factors
    102882717 (BUB3)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     102882717 (BUB3)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 102882717
NCBI-ProteinID: XP_006912937
LinkDB
Position
Unknown
AA seq 326 aa
MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVL
DCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTV
KLWDPRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKY
QTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAI
SFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYE
MDDTEHPEDGIFIRQVTDAETKPKST
NT seq 981 nt   +upstreamnt  +downstreamnt
atgacgggttctaatgagttcaagctgaaccagccacctgaggacggcatctcctccgtg
aagttcagccccaacacctcccagttcctgttggtctcctcatgggacacgtcggtgcgc
ctctacgatgtgccggccaactccatgcggctcaagtaccagcacactggcgcggtcctg
gactgcgccttctacgatccaacgcatgcctggagtgggggattagatcatcagttgaaa
atgcatgatttgaacactgatcaagagaatcttgttggaacccatgatgcccctatcaga
tgtgttgaatactgtccagaagtgaatgtgatggttactgggagttgggatcagacagtt
aaattgtgggatcccagaactccttgtaatgctgggaccttctctcagcctgaaaaggta
tatacgctctccgtgtctggggaccggctgatcgtgggcaccgcgggccgcagggtgctg
gtgtgggacctgcggaacatgggctacgtgcagcagcgccgggagtccagcttgaagtac
cagacgcgctgcatacgagcgtttccaaacaagcagggttatgtattgagctccattgaa
ggccgagtggcggttgagtacctggacccaagccccgaggtacagaagaagaagtatgcc
ttcaagtgtcacagactgaaagaaaataacattgagcagatttaccccgtcaatgccatt
tcctttcacaatatccacaacacatttgccacaggtggttctgatggatttgtaaatatt
tgggatccatttaacaaaaagcgattgtgccagttccatcggtaccccacgagcatcgca
tcgcttgccttcagtaatgacgggactacccttgccatagcatcatcatatatgtatgaa
atggatgacacggaacatcctgaagatggtatcttcattcgccaagtgacagatgcagaa
acaaaacccaagtccacctaa

DBGET integrated database retrieval system