KEGG   Pteropus alecto (black flying fox): 102882780Help
Entry
102882780         CDS       T02993                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00511  Other glycan degradation
pale00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102882780 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102882780 (NEU2)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102882780 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR
Motif
Other DBs
NCBI-GeneID: 102882780
NCBI-ProteinID: XP_006906685
UniProt: L5L230
LinkDB All DBs
Position
Un
AA seq 379 aa AA seqDB search
MASCSVLQKERVFQSGAHAYRIPALLYLPQQKTLLAFAEKRTSKKDEHAELIILRRGSYD
ASTQQVQWHAQEEVAQAQLEGHRSMNPSPVYDEKTGILFLFFIAIPSQISEHHQLHSRVN
VTLLCQVTSTDHGRSWSPARDLTSSAIGPAYKEWATFAVGPGHCLQLHNRTQSLVVPAYA
YRNLQGHQQPCPFSFCFISHDHGLTWERGSFVTQDTLECQVAEVGGAKQRVVYLNARSSL
HARVQAESTNDGLDFGGIQPVQKLVEPPHGCHGSVVSFPSPSGESESSGTWLLYTHPTDP
QQRSNLGAYLNTRPPAPEAWSQPTLLARGSCAYSDLQSLGTGLDGSPQFGCLYESDNYEE
IVFLMFTLKQAFPAEFSSR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctgctccgtcctgcagaaggagagggtgttccagtcgggagcccacgcctac
agaatcccggctctgctctacctgccacagcagaagactctgctggccttcgcagaaaag
cggacgagcaagaaggatgagcacgcagagctgatcatcctacgcagaggaagctacgat
gcgtctacccagcaggtccagtggcatgctcaagaggaggtagcccaagcccaactggaa
ggccaccggtccatgaaccccagccccgtgtatgacgagaagacggggatcctcttcctc
ttcttcattgccatccccagtcagatctctgaacaccaccagctccacagcagggtcaat
gtgacgctgctgtgccaagtcaccagcaccgaccacgggaggtcctggagccccgccaga
gacctcacgagctcagccattggcccggcctacaaggaatgggccactttcgcggtgggc
ccgggccactgtctgcagttgcacaataggacgcagagcctggtggtgccggcctacgcc
tatcggaacctccaaggccaccagcagccttgccccttctctttctgcttcatcagccac
gaccacgggctcacgtgggaaagaggcagcttcgtgacccaggacaccctggagtgccaa
gtggctgaggtggggggtgccaaacagagggtggtgtacctgaacgctagaagctccctc
catgccagggtccaggccgagagcaccaacgacgggctagatttcggggggatccaacca
gtgcagaagcttgtggagcctccccacggctgccacgggagtgtcgtcagcttccccagc
cccagcggggagtcagaatcctcgggcacgtggctactctacactcaccccactgacccc
cagcagaggtccaacctgggtgcctacctcaacacacggcccccggcccccgaggcctgg
tcccagcccaccctgctggccaggggcagctgcgcctactcagacctccagagcctgggc
accggccttgacggctcaccccagtttgggtgtctgtatgaatcggataactacgaggag
atcgtcttcctgatgttcaccctgaaacaagccttcccagctgaattctcctctcggtga

DBGET integrated database retrieval system