KEGG   Pteropus alecto (black flying fox): 102883128
Entry
102883128         CDS       T02993                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00562  Inositol phosphate metabolism
pale01100  Metabolic pathways
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04020  Calcium signaling pathway
pale04062  Chemokine signaling pathway
pale04064  NF-kappa B signaling pathway
pale04066  HIF-1 signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04072  Phospholipase D signaling pathway
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04380  Osteoclast differentiation
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04625  C-type lectin receptor signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04670  Leukocyte transendothelial migration
pale04722  Neurotrophin signaling pathway
pale04750  Inflammatory mediator regulation of TRP channels
pale04919  Thyroid hormone signaling pathway
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05214  Glioma
pale05223  Non-small cell lung cancer
pale05225  Hepatocellular carcinoma
Module
pale_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102883128 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102883128 (PLCG2)
   04014 Ras signaling pathway
    102883128 (PLCG2)
   04370 VEGF signaling pathway
    102883128 (PLCG2)
   04064 NF-kappa B signaling pathway
    102883128 (PLCG2)
   04066 HIF-1 signaling pathway
    102883128 (PLCG2)
   04020 Calcium signaling pathway
    102883128 (PLCG2)
   04070 Phosphatidylinositol signaling system
    102883128 (PLCG2)
   04072 Phospholipase D signaling pathway
    102883128 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102883128 (PLCG2)
   04613 Neutrophil extracellular trap formation
    102883128 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    102883128 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    102883128 (PLCG2)
   04662 B cell receptor signaling pathway
    102883128 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    102883128 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    102883128 (PLCG2)
   04670 Leukocyte transendothelial migration
    102883128 (PLCG2)
   04062 Chemokine signaling pathway
    102883128 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102883128 (PLCG2)
   04919 Thyroid hormone signaling pathway
    102883128 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102883128 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102883128 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    102883128 (PLCG2)
   04380 Osteoclast differentiation
    102883128 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102883128 (PLCG2)
   05206 MicroRNAs in cancer
    102883128 (PLCG2)
   05205 Proteoglycans in cancer
    102883128 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102883128 (PLCG2)
   05214 Glioma
    102883128 (PLCG2)
   05223 Non-small cell lung cancer
    102883128 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102883128 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102883128 (PLCG2)
   05171 Coronavirus disease - COVID-19
    102883128 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102883128 (PLCG2)
   05169 Epstein-Barr virus infection
    102883128 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102883128 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102883128 (PLCG2)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102883128 (PLCG2)
Membrane trafficking [BR:pale04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102883128 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102883128 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like GDPD
Other DBs
NCBI-GeneID: 102883128
NCBI-ProteinID: XP_006909763
UniProt: L5KTA0
LinkDB
Position
Unknown
AA seq 1265 aa
MTTMVNVDTLPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGSQFVLSTLSLAADSKEDAT
KWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPMVNFKVGSA
KFLKDKFVEIGAHKDELSFEQFHLLYKKLMFEQQKSIFDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDIQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCGVEQQRYMARV
FKEVFGDLLLIKPTEASADQLPSPTQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTVEEELPQDTPPTELHFGEKWFHKKVEKR
ISAEKLLQEYCNETGGKDGTFLVRESERFPNDYTLSFWRSGRVQHCRIRSTMEGGIMKYY
LTDNLMFTSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRKREGTDSYAITFRAKGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMKLRYPVTPELLERYNMERDVNSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKQSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTVDVEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDKVEELFEWF
HSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSVVRQKPIDLLKYNLKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKY
MQMNQALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgaccaccatggtcaacgtggacacccttccggaatacgagaagagccagatcaagagg
gccttggagctgggcacggtgatgactgtgttcagcttccgcaagtccaccccggagcgg
aggactgtccaggtgatcatggagacacggcaagtggcctggagtaagacggctgacaag
atcgagggcttcttggatatcatggaaataaaggaaatccgccccgggaagaactccaag
gatttcgagcgtgcaaaagcagtccgccagaaggaagactgctgtttcaccatcttgtat
ggcagccagttcgtcctcagcacactcagtttagcagctgactctaaggaagatgcaact
aagtggctctctggcttgaaaatcttacaccaagaagcgatgagcgcgtccacacccacc
attatcgagagttggctgagaaagcagatttattctgtggatcaaaccaggagaaatagc
atcagcctccgagagttgaagaccatcttgcccatggtcaacttcaaagtaggcagtgcc
aagttcctcaaagataagtttgtggaaataggcgcacacaaagatgaactcagctttgaa
cagttccacctcctctataaaaagcttatgtttgaacaacaaaaatcgatttttgacgaa
ttcaaaaaagattcctccgtgttcatcttgggcaacaccgaccggccggatgcctccgct
gtccacttgcacgacttccagcggtttctcttacatgaacagcaggagcactgggctcag
gatctgaacaaagtccgtgagcggatgaccaaatttattgatgacacgatgagggaaact
gccgagcccttcttgtttgtcgatgagttcctcacatacctgttttcacgggagaacagc
atttgggatgaaaagtatgacgtggtagacatacaggacatgaacaaccccttatcccat
tactggatctcctcatcacataacacgtacctcacaggtgaccagctgcggagtgagtca
tccacggaagcatacatccgctgtctgcgcatgggctgtcgctgcattgagctggactgc
tgggacgggcccgatgggaagcccatcatctaccatggctggacacggaccaccaagatc
aagtttgatgacgtcgtgcaggccatcaaagaccatgcctttgtcacctcaagcttccct
gtgatcctgtccatcgaggagcactgtggcgtggagcagcagcgctacatggccagagtg
ttcaaggaggtgtttggcgacttgctgctgataaagcccacggaggccagtgccgaccag
ctgccctcgcccacccagctgcgcgagaagatcatcatcaagcataagaagctgggcccc
cgaggtgatgtagatgtcaacatggaggacaagaaagatgagcacaagcaacagggtgaa
ctgtacatgtgggattccattgaccagaaatggactaggcactactgcgccattgctgat
gccaagttgtccttcagcgatgacattgaacagactgtggaagaggagctaccccaggat
acgccccccacagaactgcattttggagagaagtggttccataagaaggtggagaagagg
ataagtgccgagaagctgctgcaggaatactgcaacgagacggggggcaaggatgggacc
ttcctggtgcgggagagtgagaggttccccaacgactacaccttgtccttctggcggtct
ggccgggtccagcactgccggatccgctccaccatggagggtgggatcatgaagtactac
ctgactgacaacctcatgttcaccagcatctacgccctcatccagcactaccgtgagacg
cacctacggtgtgccgagttcgagctccggctcaccgaccccgtgcccaaccccaacccc
catgagtcaaagccgtggtactatgatgggctgagccgcggagaagcagaggacatgctg
atgagggttccccgggacggggccttcctcatccggaagcgagaaggtaccgactcgtac
gccatcaccttcagggccaagggcaaggtgaagcactgtcgcatcaaccgggatggccgg
cactttgtgctagggacctctgcctactttgagagcctggtggaactcgtcagttactac
gagaagcacgcgctctaccgaaagatgaaactgcgctaccccgtgacccccgagctcctg
gaacgctacaatatggaaagagatgtaaactccctgtatgacgtcagcagaatgtatgtg
gatcccagtgaaatcaatccttctatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcagagtgatgagctgagcttttgccgtggtgctctcattcacaacgtctcc
aaggaacccgggggctggtggaaaggagactacggaaccagaatccagcagtacttcccg
tctaattacgtcgaggacatttcaacagtggatgtggaggagctggagaagcagattatt
gaagacaatcccttagggtctctttgcagaggaatattggatctcaacacctataacgtt
gtgaaagccccacaagggaaaaaccagaagcctttcgtctttatcctggagcccaagaag
cagggtgaccctccggtggagtttgccacagacaaggtggaagagctctttgagtggttt
cacagcattcgggagatcacctggaagattgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtcgattgccatcgagctctcggacctggtcgtctactgcaaaccaacc
agcaagaccaaggacaatttagaaaaccccgacttccgagaaatccgctcctttgtggag
acgaaggctgacagcgtcgtcagacagaaacccattgatctcctgaagtacaatctaaag
ggcctgacccgcgtttacccgaagggacagagggtggactcctccaactacgatcccttc
cgcctctggctgtgtggctcccaaatggtggcgctcaatttccagacagcagataaatac
atgcagatgaatcaggccttgttttcactcaatgggcggactggctacgtcctacagcct
gagagcatgaggacggagaagtatgaccccatgccgcctgagtcccagcggaagatcctg
atgaccttgacagtcaaggttctcggggctcgacatctccccaagcttggacgaagtatt
gcgtgtccctttgtggaggtggaaatatgtggagctgaatatgacaacaacaagtttaag
acgacggttgtgaatgacaatggcctaagccctgtttgggctccaacacaggagaaggtg
acatttgaaatttatgacccaaaccttgcatttctgcgctttgtggtgtacgaggaagat
atgttcagtgaccccaacttcctggctcatgctacctaccccattaaaggaattaaatca
ggatttagatctgttcctctgaagaacgggtacagtgaagacattgaactggcttccctc
ctggttttctgtgagatgcggccagtcctggagagtgaagaggaactgtactcctcctgt
cgccagctgcggaggcggcaagaagagctgaacaaccagctctttctgtatgacacacac
cagaacttgcgcaatgccaaccgggatgccctggtgaaagagttcaacgtcaacgagaac
cagctccagctgtaccaggagaagtgcaaccgcaggttaagagagaagagagtcagcaac
agcaagttttactcatag

KEGG   Pteropus alecto (black flying fox): 102896228
Entry
102896228         CDS       T02993                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00562  Inositol phosphate metabolism
pale01100  Metabolic pathways
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04062  Chemokine signaling pathway
pale04064  NF-kappa B signaling pathway
pale04066  HIF-1 signaling pathway
pale04070  Phosphatidylinositol signaling system
pale04072  Phospholipase D signaling pathway
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04613  Neutrophil extracellular trap formation
pale04650  Natural killer cell mediated cytotoxicity
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04670  Leukocyte transendothelial migration
pale04722  Neurotrophin signaling pathway
pale04750  Inflammatory mediator regulation of TRP channels
pale04919  Thyroid hormone signaling pathway
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale05012  Parkinson disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05135  Yersinia infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05214  Glioma
pale05223  Non-small cell lung cancer
pale05225  Hepatocellular carcinoma
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
pale_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102896228 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102896228 (PLCG1)
   04014 Ras signaling pathway
    102896228 (PLCG1)
   04015 Rap1 signaling pathway
    102896228 (PLCG1)
   04370 VEGF signaling pathway
    102896228 (PLCG1)
   04064 NF-kappa B signaling pathway
    102896228 (PLCG1)
   04066 HIF-1 signaling pathway
    102896228 (PLCG1)
   04020 Calcium signaling pathway
    102896228 (PLCG1)
   04070 Phosphatidylinositol signaling system
    102896228 (PLCG1)
   04072 Phospholipase D signaling pathway
    102896228 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102896228 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    102896228 (PLCG1)
   04660 T cell receptor signaling pathway
    102896228 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    102896228 (PLCG1)
   04659 Th17 cell differentiation
    102896228 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    102896228 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    102896228 (PLCG1)
   04670 Leukocyte transendothelial migration
    102896228 (PLCG1)
   04062 Chemokine signaling pathway
    102896228 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102896228 (PLCG1)
   04919 Thyroid hormone signaling pathway
    102896228 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102896228 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102896228 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    102896228 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102896228 (PLCG1)
   05206 MicroRNAs in cancer
    102896228 (PLCG1)
   05205 Proteoglycans in cancer
    102896228 (PLCG1)
   05231 Choline metabolism in cancer
    102896228 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102896228 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102896228 (PLCG1)
   05214 Glioma
    102896228 (PLCG1)
   05223 Non-small cell lung cancer
    102896228 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102896228 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    102896228 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102896228 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102896228 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102896228 (PLCG1)
   05171 Coronavirus disease - COVID-19
    102896228 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102896228 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102896228 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102896228 (PLCG1)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102896228 (PLCG1)
Membrane trafficking [BR:pale04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102896228 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102896228 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 PH C2 SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 102896228
NCBI-ProteinID: XP_015452471
LinkDB
Position
Unknown
AA seq 1302 aa
MTLFYSKKSQRPERKTFQVKLETRQITWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQ
EDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIE
RWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFA
QLYRSLMYSAQKTMDLPFLEASALRVGERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQ
EFMLSFLRDPLREIEEPYFCLDEFVTFLFSKENSVWNSQLDAVCPDTMHNPLSHYWISSS
HNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVL
HTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPSQ
LKRKILIKHKKLAEGSAYEEVPTSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTS
SKIYYSEETSSDQGNEDEEEPKEASSSTELHSNEKWFHGKLGAGRDGRHIAERLLTEYCI
ETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYD
LITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVR
KRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRY
PINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFTK
SAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVSPAALEPEREHLDENSPLGDLLRG
VLDVPACQIAIRPEGKNNRLFVFSISMASAQWSLDVAADSQEELQDWVKKIREVAQTADA
RLTEGKMMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKA
KGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFM
TGGHCGYVLQPGTMRDEAFDPFDKSSLRGLEPCAICIEVLGARHLPKNGRGIVCPFVEIE
VAGAEYDSTKQKTEFVGEPSFTPSPHPPRDTEASELRSRRPLRTMTPSSPGGGLRLFPLA
FTVDNGLNPMWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRA
VPLKNNYSEDLELASLLVKIDIFPAKQENGDLSPFGGMSLRERSSDASGQLFHGRAREGS
FEARYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3909 nt   +upstreamnt  +downstreamnt
atgactttgttctactccaagaagtcgcagcggcccgaacggaagaccttccaggtcaag
ctggagacgcggcagatcacgtggagccgtggcgccgacaagattgaaggggccattgac
attcgtgaaatcaaggagatccgcccagggaagacctcacgagacttcgatcgctatcaa
gaggaccctgctttccgaccggaccagtcacactgctttgtcatcctgtatggaatggaa
ttccgcctgaagaccctgagcctgcaagctacatctgaggatgaagtgaacatgtggatc
aagggcttgacttggctgatggaggatacattgcaggcagctacacccctgcagattgag
aggtggctgcggaaacagttctactcggtggatcggaatcgtgaggatcgtatatcagcc
aaggacctgaagaacatgctgtcccaggtcaactaccgagtccccaacatgcgtttcctc
cgagagcggctgacggacctggagcagcgcagcagtgacatcacctatgggcagtttgct
cagctgtaccgcagcctcatgtacagcgcccagaagacgatggacctccccttcttggaa
gccagtgccctgagggtgggggagcggccagagctctgccgagtgtctcttcctgagttc
cagcagttcctcctggagtaccagggggagctatgggctgtcgaccggctccaagtacag
gagttcatgctcagcttcctccgagaccccttgcgagagattgaggagccctacttctgc
ctggatgagtttgtcaccttcctgttctccaaagagaacagtgtgtggaactcacagctg
gatgcggtgtgcccggacaccatgcacaaccctctctcccactactggatctcctcctcg
cacaatacgtacctgaccggggaccagttctccagcgagtcctccctggaagcctatgct
cgctgcctgcggatgggctgtcgctgcatcgaattggactgctgggacggcccagatggg
atgccagtcatttaccatggacacacgctgaccaccaagatcaagttctccgatgtcctg
cacaccatcaaggagcacgcctttgtggcctcagagtacccagtcatcctgtctatcgag
gaccactgcagcattgcccagcagaggaacatggcccagtacttcaagaaggtgcttggg
gacacactcctcaccaagcccgtggacatcgctgccgacgggctcccttcacccagccag
ctgaagagaaagatccttatcaagcacaagaagctggctgagggcagtgcctacgaggag
gtgcctacgtctgtcatgtactctgagaatgacatcagcaactccatcaagaatggcatc
ctctacctagaggaccccgtgaaccatgagtggtatccccattacttcgttctgaccagc
agcaagatctactactctgaggagaccagcagtgaccaaggcaacgaggatgaggaagag
cccaaggaggccagtagcagcacagagctgcactccaacgagaagtggttccacgggaag
ctcggggcaggacgggacgggcggcacatcgccgagcgcctgctcaccgagtactgcatt
gagaccggggcccctgatggctccttcctggtgcgcgagagcgagaccttcgtgggcgac
tacaccctctcgttctggcggaacgggaaggtccaacactgccggatccactcccggcaa
gacgctgggacccccaagttcttcctgacagacaacctcgtcttcgactcactctacgac
ctcatcacgcactaccagcaggtgcccctgcgctgcaacgaattcgagatgcgcctgtcg
gagcctgtgccacagaccaatgcccacgagagcaaggagtggtaccatgcaagcctgacc
agagcacaggctgagcacatgctgatgcgtgtcccccgcgatggcgccttcctggtgcgg
aaacggaatgagcccaactcctacgccatctccttccgggctgagggcaagatcaagcac
tgccgtgtccagcaggagggccagacagtgatgctgggtaactcagagttcgacagcctc
gtcgacctcatcagctactatgagaagcacccgctgtaccgcaagatgaagctgcgctac
cccatcaatgaggaggcgctggagaagattggcacagctgagccggactatggggccctg
tacgagggacgtaaccctggcttctacgtggaggcaaacccgatgccgaccttcaagtgt
gcggtcaaagccctctttgactacaaggcccagagagaggatgagctgactttcaccaag
agcgccatcatccagaacgtggagaagcaggagggaggctggtggcggggagactatggt
gggaagaagcagctatggttcccgtcaaactacgtggaagagatggtcagcccggcggcc
ctggagcctgagagggagcacttggacgagaacagccccttgggggacttactgcggggg
gtcttggatgttccagcttgtcagattgccatccgtcccgagggcaagaacaatcgactg
ttcgtcttctcaatcagtatggcatcagcgcagtggtccctggatgtcgctgctgactca
caagaggagctgcaggactgggtgaaaaagatccgtgaagtggctcagaccgcagatgcc
aggctcactgaggggaagatgatggaacggaggaagaagatcgccctggagctgtctgag
cttgtcgtctactgccggcctgttccttttgatgaagagaagattggcacagaacgcgcc
tgctaccgcgacatgtcatccttcccggaaaccaaggctgagaaatacgtgaacaaggcc
aaaggcaagaagttcctccagtacaaccggctgcagctgtcccgcatctaccccaaaggc
cagcggctggactcttccaactatgatcccttgcccatgtggatctgtggcagtcagctg
gtggccctcaacttccagaccccagacaagcctatgcagatgaaccaggccctcttcatg
accggtgggcactgtggctatgtgctgcagcccggcaccatgcgggacgaggcctttgac
ccctttgataagagcagcctccgcgggctggagccatgcgccatctgcatcgaggttctg
ggcgcccggcatctgccgaagaatggccggggcattgtgtgtccctttgtggagattgag
gtggctggagctgagtatgacagcaccaagcagaagacagagtttgtgggtgagccttcc
ttcaccccgtctcctcatcctcccagagataccgaggcatcagagctccgctcccgcaga
ccccttcgcaccatgaccccatcttctccaggcggtggcctgaggctttttccccttgct
ttcacagtggacaatggcttgaaccccatgtggccggccaagcccttccacttccagatc
agtaaccctgaattcgccttcctgcgctttgtggtatatgaagaagacatgtttagtgat
cagaacttcctggctcaggctactttcccagtgaaaggcctaaagacagggtacagagcg
gtccctttgaagaacaactacagcgaggacctggagttggcctccctgctggtcaagatc
gacattttccctgccaagcaggagaacggcgacctcagtcccttcggtggtatgtccctg
cgggagcggagctctgatgcctcaggccagctgtttcatggccgggcccgcgaaggctcc
tttgaagcccgctaccagcagccatttgaggattttcgcatctcccaggagcatcttgcg
gaccactttgacagtcgggaacgaagggccccacggaggactcgggtcaatggagacaac
cgcctctag

DBGET integrated database retrieval system