KEGG   Pteropus alecto (black flying fox): 102883166
Entry
102883166         CDS       T02993                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04066  HIF-1 signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102883166 (EPO)
   04066 HIF-1 signaling pathway
    102883166 (EPO)
   04151 PI3K-Akt signaling pathway
    102883166 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102883166 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102883166 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102883166 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102883166 (EPO)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102883166 (EPO)
SSDB
Motif
Pfam: EPO_TPO CTX_RstB
Other DBs
NCBI-GeneID: 102883166
NCBI-ProteinID: XP_006918668
LinkDB
Position
Unknown
AA seq 193 aa
MGVRECPALLLLLSLLLLPLGLPVLGAPPRLICDSRVLERYILEAKEAENVTVGYGEGCS
FSENITVPDTKVNFYAWKRMEIEQQAVEVWQGLALLSEAILRGQGLLANSSQPSEILQLH
VDKAISSLRSLTSLLRALGAQKEAISFPEATASAAPLRTFTVDTLCKLFRIYSNFLRGKL
KLYTGEACRRGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcgcgaatgtcctgccctgctgctcctgctgtccttgctgctgcttcctctg
ggcctcccagtcctgggcgctcccccacgcctcatctgtgatagccgagtcctggagagg
tacatcctggaggccaaggaggctgaaaatgtcacggtgggctatggggaaggctgcagc
ttcagtgagaatatcaccgtcccagacaccaaggttaacttctatgcctggaagaggatg
gagattgagcagcaggccgtggaagtctggcagggcctggccctgctctcagaagccatc
ctgcgaggacagggcctgttggccaactcctcccagccatctgagatcctgcagctacat
gtggacaaagccatcagtagcctacgcagcctcacctccctacttcgggcgctgggagcc
cagaaggaagccatctcctttccagaagcaacagcatctgctgctccactccgaacattc
actgttgatactttgtgcaaacttttccgaatctactccaatttccttcggggaaagctg
aagctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system