KEGG   Pteropus alecto (black flying fox): 102883204
Entry
102883204         CDS       T02993                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04060  Cytokine-cytokine receptor interaction
pale04068  FoxO signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04217  Necroptosis
pale04650  Natural killer cell mediated cytotoxicity
pale04722  Neurotrophin signaling pathway
pale04932  Non-alcoholic fatty liver disease
pale04940  Type I diabetes mellitus
pale05022  Pathways of neurodegeneration - multiple diseases
pale05142  Chagas disease
pale05143  African trypanosomiasis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05168  Herpes simplex virus 1 infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05320  Autoimmune thyroid disease
pale05330  Allograft rejection
pale05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102883204 (FASLG)
   04014 Ras signaling pathway
    102883204 (FASLG)
   04068 FoxO signaling pathway
    102883204 (FASLG)
   04151 PI3K-Akt signaling pathway
    102883204 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102883204 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102883204 (FASLG)
   04217 Necroptosis
    102883204 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102883204 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102883204 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102883204 (FASLG)
   05205 Proteoglycans in cancer
    102883204 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102883204 (FASLG)
   05330 Allograft rejection
    102883204 (FASLG)
   05332 Graft-versus-host disease
    102883204 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    102883204 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102883204 (FASLG)
   04932 Non-alcoholic fatty liver disease
    102883204 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102883204 (FASLG)
   05161 Hepatitis B
    102883204 (FASLG)
   05160 Hepatitis C
    102883204 (FASLG)
   05164 Influenza A
    102883204 (FASLG)
   05162 Measles
    102883204 (FASLG)
   05168 Herpes simplex virus 1 infection
    102883204 (FASLG)
   05163 Human cytomegalovirus infection
    102883204 (FASLG)
   05165 Human papillomavirus infection
    102883204 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102883204 (FASLG)
   05143 African trypanosomiasis
    102883204 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102883204 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pale04147]
    102883204 (FASLG)
   04052 Cytokines and growth factors [BR:pale04052]
    102883204 (FASLG)
   04090 CD molecules [BR:pale04090]
    102883204 (FASLG)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102883204 (FASLG)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Tumor necrosis fators
   102883204 (FASLG)
CD molecules [BR:pale04090]
 Proteins
  102883204 (FASLG)
SSDB
Motif
Pfam: TNF Lectin_N EMP24_GP25L GutM
Other DBs
NCBI-GeneID: 102883204
NCBI-ProteinID: XP_006907864
LinkDB
Position
Unknown
AA seq 283 aa
MQQPLNYPYPQIYWVDSSASSPWAPPGSVLPCPASAPRRPGQRRPPPPPPPPLPPTLLPP
LPPLPPPPPPPPLKKSRDHNTGLCLLVMFFMILVALVALGLGMFQLFHLQRELAELREST
SQRHVASSLEKQIGHPSPPSEKKEPRKVAHLTGKPNSRSMPLEWEDTYGIALVSGVKYKK
GGLVINDTGLYFLYSKVYFRGQSCSNQPLSHKVYMRNSKYPHDLVLMEGRMMNYCTTGQM
WARSSYLGAVFNLTCADHVYVNVSELSLVSFEESKTFFGLYKL
NT seq 852 nt   +upstreamnt  +downstreamnt
atgcagcagcccttaaactacccatacccccaaatctactgggtggacagcagcgccagc
tcgccctgggctcctccggggtcagtcctcccctgtccggcctcggcgcccaggaggccg
ggtcaaaggaggccaccgccgccacctccgccgccactgccaccaacactactgccgccg
ctgccacctctgccaccgccaccgccaccgccacctctgaagaagagcagggaccacaac
acaggcttgtgtctcctcgtgatgttcttcatgatcctggtggccctggtcgccctgggc
ctggggatgtttcagctcttccacctgcagagggagctggccgaactcagagagtccacc
agccaaaggcatgtggcatcatctttggagaagcaaataggtcaccccagtccgccctcc
gaaaaaaaggagccgaggaaagtggcccatttgacaggcaagcccaactcaagatccatg
cccctggagtgggaagatacctatggaattgccctggtctctggggtgaagtataagaag
ggtggccttgtgatcaacgacaccgggctatacttcctgtactccaaggtgtacttccgg
ggccagtcctgcagcaaccagcccctgagccacaaggtctacatgagaaactctaagtac
ccccacgacctggtgctgatggaggggaggatgatgaactactgcactaccggccagatg
tgggcccgcagcagctacctgggcgccgtgttcaatctcacctgtgctgaccatgtgtat
gtcaatgtgtcggagctctcgctggtcagttttgaggaatcgaagacatttttcggctta
tataagctctag

DBGET integrated database retrieval system