KEGG   Pteropus alecto (black flying fox): 102883387
Entry
102883387         CDS       T02993                                 

Gene name
XPA
Definition
(RefSeq) DNA repair protein complementing XP-A cells isoform X1
  KO
K10847  DNA-repair protein complementing XP-A cells
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    102883387 (XPA)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102883387 (XPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pale03400]
    102883387 (XPA)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     102883387 (XPA)
SSDB
Motif
Pfam: XPA_C XPA_N TipAS
Other DBs
NCBI-GeneID: 102883387
NCBI-ProteinID: XP_006911612
UniProt: L5KNS9
LinkDB
Position
Unknown
AA seq 273 aa
MAAAEVTSPEPAASEQSAELPASLRASIERKRQRALMLRQARLAARPYAATAVAATGGMA
NVKAAPKIIDTRGGFILEEEEEEKHTIGNVVHQPGPVMEFDYAICEECSREFMDSYLMNH
FDLATCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPALKFIVKKNPHHSQWGDMKL
YLKLQIEKRALEVWGSQEALEEAKEVRQKNREKMKQKKFDKKVKELRRAVRSSVWKRETA
AHQHEYGPEESLEDDMYRKTCTVCGHELTYEKM
NT seq 822 nt   +upstreamnt  +downstreamnt
atggcagcggccgaggtaacttcgccggagccggcggcttcagaacagtcggcggagctg
ccagcctctttgcgggcgagcatcgagcggaagcggcagcgggcgttgatgctgcgccag
gcccggctggccgcccggccctacgcggcgacggcggttgcggctaccggaggcatggct
aatgtaaaagcagccccaaagataattgacacaagaggaggcttcattctggaagaggaa
gaagaagaaaaacatacaattgggaatgttgttcatcaaccaggacctgttatggaattt
gattatgcaatatgcgaagaatgtagtagagaatttatggattcttatcttatgaaccac
tttgatttggcaacttgtgataactgcagagatgctgatgataaacacaagcttataact
aaaacagaagcaaaacaagaataccttctgaaagactgtgatttagaaaaaagagaacca
gctcttaaatttattgtgaagaagaatcctcatcattctcagtggggtgatatgaaactc
tacttaaaattacagattgagaagagggctctcgaagtttggggaagtcaggaagcatta
gaagaagccaaggaagttcgacagaaaaaccgagaaaaaatgaaacagaagaagtttgat
aaaaaagtaaaagaattacggcgagcagtaagaagcagtgtttggaaaagggaaacagct
gctcaccagcatgagtatggaccagaagaaagcctagaagatgacatgtaccggaagact
tgtactgtgtgtggccatgaattgacatatgagaaaatgtga

DBGET integrated database retrieval system