KEGG   Pteropus alecto (black flying fox): 102883490
Entry
102883490         CDS       T02993                                 

Gene name
FHIT
Definition
(RefSeq) bis(5'-adenosyl)-triphosphatase isoform X2
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale01100  Metabolic pathways
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102883490 (FHIT)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102883490 (FHIT)
   05223 Non-small cell lung cancer
    102883490 (FHIT)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     102883490 (FHIT)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 102883490
NCBI-ProteinID: XP_006917561
LinkDB
Position
Unknown
AA seq 149 aa
MSFRFGQHLIKPSVVFLKTELSFAFVNRKPVVPGHVLVCPLRPVERFRDLHPNEVADLFQ
ATQRVGTVVEKHFQGTSLTFAMQDGPEAGQTVKHVHIHVLPRKAGDFHRNDSIYDELQKH
DKEKEDSPTLWRSEEEMAAEAAALRVYFQ
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtctttcagattcggccaacatctcatcaagccctctgtggtatttctcaaaacagaa
ctgtcctttgccttcgtgaacaggaaacctgtggtaccaggacatgtcctcgtgtgtcct
cttcgtccagtggagcgcttccgagatctgcatcccaatgaagtggctgatttgtttcag
gcaacccagagagtcgggacagtggtggagaagcatttccagggaacttcccttaccttt
gccatgcaagatggccccgaagctggacagactgtgaagcacgttcacatccacgttctt
cccaggaaggctggagactttcacaggaatgacagcatctatgatgagctccaaaagcat
gacaaagagaaagaggactccccaaccttgtggagatcagaagaagaaatggcggcagaa
gctgcagcactgcgggtctactttcagtga

DBGET integrated database retrieval system