KEGG   Pteropus alecto (black flying fox): 102883540
Entry
102883540         CDS       T02993                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04141  Protein processing in endoplasmic reticulum
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05160  Hepatitis C
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05203  Viral carcinogenesis
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05216  Thyroid cancer
pale05217  Basal cell carcinoma
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102883540 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102883540 (BAK1)
   04215 Apoptosis - multiple species
    102883540 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102883540 (BAK1)
   05202 Transcriptional misregulation in cancer
    102883540 (BAK1)
   05206 MicroRNAs in cancer
    102883540 (BAK1)
   05203 Viral carcinogenesis
    102883540 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102883540 (BAK1)
   05212 Pancreatic cancer
    102883540 (BAK1)
   05225 Hepatocellular carcinoma
    102883540 (BAK1)
   05226 Gastric cancer
    102883540 (BAK1)
   05214 Glioma
    102883540 (BAK1)
   05216 Thyroid cancer
    102883540 (BAK1)
   05220 Chronic myeloid leukemia
    102883540 (BAK1)
   05217 Basal cell carcinoma
    102883540 (BAK1)
   05218 Melanoma
    102883540 (BAK1)
   05213 Endometrial cancer
    102883540 (BAK1)
   05224 Breast cancer
    102883540 (BAK1)
   05222 Small cell lung cancer
    102883540 (BAK1)
   05223 Non-small cell lung cancer
    102883540 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    102883540 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102883540 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102883540 (BAK1)
   05160 Hepatitis C
    102883540 (BAK1)
   05164 Influenza A
    102883540 (BAK1)
   05162 Measles
    102883540 (BAK1)
   05168 Herpes simplex virus 1 infection
    102883540 (BAK1)
   05163 Human cytomegalovirus infection
    102883540 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102883540 (BAK1)
   05169 Epstein-Barr virus infection
    102883540 (BAK1)
   05165 Human papillomavirus infection
    102883540 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102883540 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pale03029]
    102883540 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102883540 (BAK1)
Mitochondrial biogenesis [BR:pale03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102883540 (BAK1)
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102883540 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 102883540
NCBI-ProteinID: XP_006907426
UniProt: L5L0Q0
LinkDB
Position
Unknown
AA seq 211 aa
MASGQCPGPPRQECEEPAPSSTSEEQVARDTEEVFRSYVFYRHQQEQEADGAAAPADPEM
VTLSLEPASTMGQVGRRLAIIGDAINQRYDEEFQTMLQRLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLTVLAVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcgtctgggcaatgcccaggccctcccaggcaggagtgtgaagagcctgccccatcc
tccacttcggaggagcaggtagcccgagacacagaagaggttttccgcagctacgttttt
taccgccatcagcaggagcaggaggctgatggggcggctgcgcctgctgacccagagatg
gtcaccttgtccctagaacctgccagcaccatggggcaggtgggacggcggctcgccatc
atcggggatgctattaaccagcgctacgacgaagagttccagaccatgttgcagcgcctg
cagccaacggcagagaacgcctatgagtatttcaccaagatcgcctccagcctatttgag
agtggcatcaactggggtcgagtggtggctctcctgggcttcggctaccgcctggcccta
catgtttaccagcgcggcctgactggcttcctgggccaagtgacccgctttgtggccgac
ttcatgctgcatcactgcattgcccggtggattgcgcagaggggcggctgggtggcagcc
ctgaacttgggcaacggccccatccttaatgtgctgacagttctggctgtggttctgttg
ggccagtttgtggtacgaagattcttcaagtcatga

DBGET integrated database retrieval system