KEGG   Pteropus alecto (black flying fox): 102883932
Entry
102883932         CDS       T02993                                 

Gene name
SLC31A1
Definition
(RefSeq) high affinity copper uptake protein 1
  KO
K14686  solute carrier family 31 (copper transporter), member 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:pale00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    102883932 (SLC31A1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102883932 (SLC31A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102883932 (SLC31A1)
Transporters [BR:pale02000]
 Solute carrier family (SLC)
  SLC31: Copper transporter
   102883932 (SLC31A1)
SSDB
Motif
Pfam: Ctr
Other DBs
NCBI-GeneID: 102883932
NCBI-ProteinID: XP_006917186
UniProt: L5K9N4
LinkDB
Position
Unknown
AA seq 189 aa
MDHSHHMGMNHMDHNSTMAPHHHPTTSASHSHGGGAGHMMMMHMTFYFGFKNVELLFSGL
VINTAGEMAGAFVGVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETHK
TVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGMGYFLFSWKKAV
VVDITEHCH
NT seq 570 nt   +upstreamnt  +downstreamnt
atggaccattcccaccatatggggatgaaccatatggaccacaacagtaccatggcacct
caccatcacccgaccacttcagcctcccactcccatggcgggggagctggccacatgatg
atgatgcacatgaccttctactttggctttaagaatgtggaactattgttttctggcttg
gtgatcaacacagctggagaaatggctggagcttttgtgggagtgtttttactagcaatg
ttctatgaaggactcaagatagcccgagagagcctgctgcgcaagtcacaagtcagcatt
cgctacaattccatgcctgtcccaggaccaaatggaaccattcttatggagacacacaaa
accgttgggcagcagatgctgagctttcctcacctcctgcagacagtgctgcatatcatc
caggtggtcatcagctacttcctcatgctcatcttcatgacctacaatgggtacctctgc
attgctgtagcagcaggggctggcatgggatactttctcttcagctggaaaaaggcagtc
gttgtggacatcacagagcattgccattaa

DBGET integrated database retrieval system