KEGG   Pteropus alecto (black flying fox): 102884014
Entry
102884014         CDS       T02993                                 

Gene name
MCL1
Definition
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04630  JAK-STAT signaling pathway
pale05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102884014 (MCL1)
   04151 PI3K-Akt signaling pathway
    102884014 (MCL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102884014 (MCL1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102884014 (MCL1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 102884014
NCBI-ProteinID: XP_006919806
UniProt: L5K399
LinkDB
Position
Unknown
AA seq 241 aa
MEVPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASNGPGTDGSLPSTPPPSEEE
EEDELYRQSLQIISRYLREQATGAKDAKPLGGPAATSRKALETLRRVGDGVQRNHETAFQ
GMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
LAESITDILVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
R
NT seq 726 nt   +upstreamnt  +downstreamnt
atggaagtcccggccgccgacgccatcatgtcgcccgaggaggagctggacgggtacgag
ccggagcctctcgggaagcggccggctgtcctgcccttgctggagctggtcggggaggcc
agtaatggccccggcacggacggctcactcccctccacgccgcccccatcagaagaggag
gaggaggacgagctgtaccggcagtcgctgcagattatctctcggtaccttcgggagcag
gcgaccggcgccaaggacgcgaagccgctgggcgggccggcggccaccagccggaaggcg
ttggagaccctgcggcgcgtcggggacggcgtgcagcgcaaccacgagacggccttccaa
ggcatgcttcggaagctggacatcaaaaacgaagacgacgtcaaatctttatctcgagtg
atggttcacgtttttagtgacggagtaacaaactggggcaggattgtgactcttatttct
tttggtgcctttgtggccaaacacttgaagagtataaaccaagaaagctgcatcgaacca
ttagcagaaagcatcacagatattctcgtaaggacaaaaagagactggctagtcaaacaa
agaggctgggatgggtttgtggagttctttcacgtagaggacctagaaggcggcatcaga
aatgtgctgctggcctttgcaggtgttgctggcgtgggagctggtttggcatatctaata
agatag

DBGET integrated database retrieval system