KEGG   Pteropus alecto (black flying fox): 102884034
Entry
102884034         CDS       T02993                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04072  Phospholipase D signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04640  Hematopoietic cell lineage
pale04916  Melanogenesis
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102884034 (KITLG)
   04014 Ras signaling pathway
    102884034 (KITLG)
   04015 Rap1 signaling pathway
    102884034 (KITLG)
   04072 Phospholipase D signaling pathway
    102884034 (KITLG)
   04151 PI3K-Akt signaling pathway
    102884034 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102884034 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    102884034 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102884034 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102884034 (KITLG)
Cytokines and growth factors [BR:pale04052]
 Growth factors
  Growth factors (RTK binding)
   102884034 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 102884034
NCBI-ProteinID: XP_006923874
LinkDB
Position
Unknown
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVKTTGICTNRITDDVKDVTKLVANLPKDYKITLKYVPG
MDILPSHCWINEMVEQLSVSLTDLLDKFSKISEGLSNYSIIDKLGKIVDDLVECMEGHTF
ENIKKSPKSLESKLFTPEEFFRIFNRSIDAFKDLDMVSSKTSECVVSSTLSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKTSNSIGNSSLQWAAMVLPAFFSLVIGFGFGALYWKK
KQSNPTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaattgctcctatttaat
cccctcgtcaaaactacagggatctgcacgaaccgcatcactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagataaccctcaaatatgtccccgga
atggacattttgcctagtcattgttggataaatgaaatggtggaacaattgtcagtcagc
ttgactgatcttctggacaagttttcaaaaatttctgaaggcttgagtaattattctatc
atagacaaacttgggaaaatagtggatgaccttgtggagtgcatggaaggacacacattc
gagaatataaaaaagtcacctaagagcctagaatccaagctatttactcctgaagaattc
tttagaatttttaatagatccatcgatgccttcaaggacttggatatggtgtcatctaaa
actagtgaatgtgtggtttcttcaacattaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaagacctcaaattccattggaaactccagcttacagtgggcagcaatggtc
ttgccagcattcttttctcttgtaattgggtttggttttggagccttatactggaagaag
aaacaatcaaatcctacaaggacagttgaaaatatacagattaatgaagaggataatgag
ataagtatgttgcaagaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system