KEGG   Pteropus alecto (black flying fox): 102884149Help
Entry
102884149         CDS       T02993                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04371  Apelin signaling pathway
pale05034  Alcoholism
pale05165  Human papillomavirus infection
pale05169  Epstein-Barr virus infection
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    102884149 (HDAC4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    102884149 (HDAC4)
  Substance dependence
   05034 Alcoholism
    102884149 (HDAC4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    102884149 (HDAC4)
   05165 Human papillomavirus infection
    102884149 (HDAC4)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102884149 (HDAC4)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102884149 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 102884149
NCBI-ProteinID: XP_015443311
LinkDB All DBs
Position
Un
AA seq 1089 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHVPSSVDVASALPLQVAPPAVPMDLRLDHQFPLA
VSEPALREQQLQQELLALKQKQQLQRQILIAEFQRQHEQLSRQHEAQLHEHVKQQQELLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCVASDPRYWYGKTQHSSLDQSSPPQSAASATYKHPALGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPMAAALKKRPLDVTDSACSSAPGSAP
SSPNNSSGSVSAENGIAPTMPSLPAETNLAHRLVTREGSMAPLPLYTSPSLPNITLGLPA
TGPSAGAAGQQEAERLALPGLQQRLALFPGTHLAPYLSTAPLERDGGPAHSPLLQHMVLL
EQPPAQAPLVPGLGALPLHAQPLVGADRVSPTVHKLRQHRPLGRTQSAPLPQSAQALQQL
VVQQQHQQFLEKHKQHFQQPFQPPQLHLSKPFLSPSEHVGSEEQGQGRTKHQQPHCVTSF
STRVSGTWTEASWLKPRRQQTALDRLGAPGAYGVRPWPVARCAPALRAARGRAGRALQKG
ATRGRLKQQCLSPQQALLLEQQRIHQLRNFQASMEAAGIPVSFGGHRPLSRAQSSPASAT
FPMSVQEPPAKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKC
ECIRGRKATLEELRTVHSEAHALLYGTNPLNRQKLDSSLTSVFVRLPCGGVGVDSDTIWN
EVHSSGAARLAVGCVVELVFRVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAK
LLQQRLSVSKMLIVDWDVHHGNGTQQAFYSDPSVLYISLHRYDDGNFFPGSGAPDEVGAG
PGVGFNVNMAFTGGLDPPMGDVEYLAAFRMVVMPIANEFGPDVVLVSSGFDAVEGHPTPL
GGYNLSAKCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEK
VLQQRPNANAVRSMEKVIEIHSRYWPSLHRLSSSVASSLVEAQQCENEEAETVTAMASLS
VGVKPAEKR
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccacccagatggactttctggccgagaccagcccgtggagctgctg
aaccccgcccgcgtgaaccacgtgcctagctcggtggatgtggcctcggcgctgcccctg
caagtggcgcccccggcggtgcccatggacctgcgcctggaccaccagttcccgctggcc
gtgtcggagcccgcgctgcgggaacagcagctgcagcaggagctcctggccctcaagcag
aagcagcagctgcagcggcaaatcctcatcgccgagttccagcggcagcacgagcagctg
tcccggcagcacgaggcccagctccacgagcacgtcaagcaacagcaggagctgctggcc
atgaagcaccagcaggagctgctggagcatcagcggaagctggagcggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaaa
ggcaaagagagtgccgtggccagcacggaggtgaagatgaagttgcaggagttcgtcctg
aacaagaagaaggcgctggcccaccgcaacctgaaccactgcgtggccagtgacccccgc
tactggtacgggaagacgcagcacagctccctggaccagagctctccgccccagagtgcg
gcatcggccacctacaagcacccggccctgggcatgtatgacgccaaggacgacttccct
ctgcggaagacagcctctgagcccaacctgaagctgcggtcccggctgaagcagaaagtg
gccgagaggcgcagcagccccttgctgcgcaggaaggacgggcccatggccgccgccctg
aagaagcgccccttggacgtcacagactccgcgtgcagcagcgccccgggctccgccccc
agctcacccaacaacagctccgggagcgtcagcgcggagaatggcatcgcgcccaccatg
cccagcctcccggccgagaccaacttggcacacagactggtgacgcgagagggctcgatg
gcccccctccccctgtacacgtcgccgtccttgcccaacatcacgctgggacttcccgcc
accggcccttctgctggggcggccggccagcaggaagccgagcgcctggctctcccaggc
ctgcagcagcggctggcgctcttccccggcacccacctcgccccctacctgagcacggcg
cccctggagcgggacggcgggccggcgcacagccccctgctgcagcacatggtactcctg
gagcagccgcctgcacaggcgcccctcgtgccaggcctgggagcgctgcccctgcacgcg
cagcccctggtgggcgcggaccgcgtgtcgccgaccgtgcacaagctgcggcagcaccgg
ccgctggggcgcacgcagtcggccccgctgccccagagcgcgcaggcgctgcagcagctg
gtggtccagcagcagcaccagcagttcctggagaagcacaagcagcatttccagcagccg
ttccagccgccgcagctgcacctgagcaagcccttcctgtccccgagtgagcacgtgggg
agtgaggagcaaggacaggggcgcacgaagcaccagcagccgcactgtgtgacgagcttt
tccacccgtgtttctggcacgtggaccgaggcctcttggttaaaaccgagacgacagcag
actgcactagacaggctgggggctcccggggcctacggtgtccgtccgtggccagtggcc
cggtgtgctcccgcactgcgcgctgcacgcgggcgggcggggcgcgctctgcagaagggt
gcgacgaggggccgcctgaagcagcagtgcctgtctccccagcaagcgctcctcctggaa
cagcagcggatccaccagctgaggaacttccaggcctccatggaggccgccggcatcccc
gtgtccttcggtggccaccggcctctgtcccgggcacagtcgtccccagcgtctgccacc
ttccccatgtctgtgcaggagccccccgccaaaccacggttcaccacaggcctggtgtac
gacacgctcatgctgaagcaccagtgcacctgcgggaacaccaacagccacccggagcac
gccggcaggatccagagcatctggtcccggctgcaggagaccggcctacgaggcaaatgc
gagtgcatccgcggacgcaaggccaccctggaggagctgcggaccgtgcactcggaggct
cacgccctgctctacggcacaaatcccctcaacaggcagaaactggacagttcgctgacg
tccgtctttgtccggctgccctgtggtggtgttggggtggacagcgacaccatatggaac
gaggtgcactcgtcgggggccgcccgcctggccgtgggctgcgtggtggagctggtgttc
agagtggccacaggggagctgaagaatggctttgccgtggtccgcccgccgggacatcac
gcggaggagagcacgcccatgggcttctgctacttcaattccgtggccatcgcagccaag
ctcctccagcagaggctgagcgtgagcaagatgctcatcgtggactgggatgtgcaccac
ggcaacgggacccagcaggccttctacagcgacccgagtgtcctgtacatctccctgcat
cgctacgacgacggcaacttcttcccgggcagcggcgcccccgacgaggtgggcgcaggg
ccaggcgtgggcttcaacgtcaacatggctttcactggtggcctcgaccccccgatgggg
gacgtggagtacctggcggccttccgaatggtcgtcatgccaatagcaaatgagtttggc
ccggacgtggtgctggtgtcgtcgggcttcgacgccgtggagggccaccccacacccctg
ggcggctacaacctctccgccaaatgtttcgggtacctgacgaagcagctgatgggcttg
gccggcggccggatcgttctggccctggaggggggccacgacctcacggccatttgcgac
gcctcggaagcatgtgtttctgctttgctgggaaacgagctcgatcctcttccagaaaag
gttctacagcagagacccaatgcgaacgccgtccgctccatggagaaggtcattgaaatc
cacagccggtactggccctcgctgcaccggctgtcgtcctcggtggcctcctccctggtc
gaggcccagcagtgcgagaacgaggaggccgagaccgtcaccgccatggcttctctgtcc
gtgggcgtgaagccagcagagaagaggtga

DBGET integrated database retrieval system