KEGG   Pteropus alecto (black flying fox): 102884316
Entry
102884316         CDS       T02993                                 

Gene name
FOSL1
Definition
(RefSeq) fos-related antigen 1 isoform X1
  KO
K04502  fos-like antigen 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04310  Wnt signaling pathway
pale04380  Osteoclast differentiation
pale04657  IL-17 signaling pathway
pale05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102884316 (FOSL1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    102884316 (FOSL1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102884316 (FOSL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102884316 (FOSL1)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    102884316 (FOSL1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 Macoilin DUF4407 TMCO5 UPF0242
Other DBs
NCBI-GeneID: 102884316
NCBI-ProteinID: XP_006911146
UniProt: L5KNK8
LinkDB
Position
Unknown
AA seq 279 aa
MFRDFGEPGPSSGAGGAYGGPAQPPATGQQKFHLVPSINAVSGSQELQWMVQPHFLGPSS
YPRPLAYPQYSHPVQSPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAK
CRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGARES
NTGGTGGTSGTSGTSGTNSPPASSRPVPCISLSPRPVLEPEALHTPTLMTTPSLTPFTSN
LVFTYPSTPEPCGSAHRRSSSSSGDPSSDPLGSPTLLAL
NT seq 840 nt   +upstreamnt  +downstreamnt
atgttccgagacttcggggaacccggacccagctccggggccggtggtgcgtacggcggc
ccggcgcagcctcccgctacaggccagcagaaattccacctcgtgccaagcatcaacgct
gtgagtggcagccaggagctgcagtggatggttcagcctcacttcctgggacccagcagc
taccctaggcctctggcttatccccagtacagccacccagtacagtccccccggccagga
gtcatccgggccctggggccacctccaggggtgcgtcgacgtccctgtgaacagatcagc
ccggaggaggaggagcgccgtcgagtgaggcgcgagcgaaacaagctggccgcggccaag
tgcaggaaccggaggaaggaactgaccgacttcctgcaggcggagaccgacaaactagag
gacgagaaatcggggctgcagcgggagattgaggagctgcagaagcagaaagagcggctg
gagttagtgctcgaagcccaccgccccatctgcaaaatcccggaaggggctagggagagc
aacactggcggcacaggcggcaccagcggtaccagcggtaccagcggcaccaacagccca
ccagcctcctcccgccctgtgccttgtatctccctttccccgaggcctgtgcttgaacct
gaagcattgcacacccccacactcatgaccaccccctctctgactcctttcacctccaat
ctggtcttcacctaccccagcacccctgagccctgtggctcagcccaccgcaggagtagc
agcagtagtggggacccatcctctgacccccttggctcccccactctcctggccttatga

DBGET integrated database retrieval system