KEGG   Pteropus alecto (black flying fox): 102884319Help
Entry
102884319         CDS       T02993                                 

Gene name
GCK
Definition
(RefSeq) LOW QUALITY PROTEIN: glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00010  Glycolysis / Gluconeogenesis
pale00052  Galactose metabolism
pale00500  Starch and sucrose metabolism
pale00520  Amino sugar and nucleotide sugar metabolism
pale00524  Neomycin, kanamycin and gentamicin biosynthesis
pale01100  Metabolic pathways
pale01200  Carbon metabolism
pale04910  Insulin signaling pathway
pale04911  Insulin secretion
pale04917  Prolactin signaling pathway
pale04922  Glucagon signaling pathway
pale04930  Type II diabetes mellitus
pale04950  Maturity onset diabetes of the young
pale05230  Central carbon metabolism in cancer
Module
pale_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pale_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102884319 (GCK)
   00052 Galactose metabolism
    102884319 (GCK)
   00500 Starch and sucrose metabolism
    102884319 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    102884319 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102884319 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102884319 (GCK)
   04910 Insulin signaling pathway
    102884319 (GCK)
   04922 Glucagon signaling pathway
    102884319 (GCK)
   04917 Prolactin signaling pathway
    102884319 (GCK)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102884319 (GCK)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102884319 (GCK)
   04950 Maturity onset diabetes of the young
    102884319 (GCK)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     102884319 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 102884319
NCBI-ProteinID: XP_006911534
LinkDB All DBs
Position
Unknown
AA seq 465 aa AA seqDB search
MPDDRARMENTKKEKVEQILAEFRLQEEDLKKVMRRMQKEMDRGLRLATHKEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSLNTKHQMYSIPEDAMTGTAE
MLFDYVSECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
VVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVGTGCNACYMEEMHN
VELVDGDEGRMCVNTEWGAFGDAGELDEFLLEYDRMVDESSLNPGQQLXAAAQGGQHHGK
LVRLVLLKLVDEDLLFHGEASEQLRTRGAFETRFVSQVESDSGDRKQIYNILSTLGLRPS
ATDCDIVRRACESVSTRAAHMCGAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
ERFHAIVRRLTPSCEITFIQSEEGSGRGAALVSAVACKKACMLGQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgccggatgacagagccaggatggagaacaccaagaaggaaaaggtcgagcagatcctg
gcggagttcaggctgcaggaggaggatctgaagaaggtgatgaggcggatgcagaaggag
atggaccgaggcctgaggctggcgactcacaaagaggccagcgtgaagatgctgcccacc
tatgtgcgctccactcctgaaggctcagaagttggggacttcctctccctggacctgggt
ggcaccaacttcagggtgatgctggtgaaggtgggagagggtgaggcagggcagtggagc
ctgaacaccaagcaccagatgtactccatccccgaggacgccatgacgggcactgctgag
atgctcttcgactatgtctccgagtgcatctccgacttcctggacaagcaccagatgaag
cacaagaagctgcccttgggtttcaccttctccttccccgtgcggcacgaggacatcgac
aagggcatccttctcaactggaccaagggcttcaaggcttccggggcagaagggaacaac
gtcgtggggctcctgcgagacgccatcaagcggagaggggactttgagatggacgtggtg
gccatggtgaacgataccgtggccacaatgatctcctgctactatgaagaccgccagtgt
gaggtcggcatgatagtgggcacgggctgcaacgcctgctacatggaggagatgcacaac
gtggagctggtggacggggacgagggccgcatgtgcgtcaacaccgagtggggggccttc
ggggacgcaggcgagctggacgagttcctgctggagtacgaccggatggtggacgagagc
tcgctgaacccgggccagcagctgtaagcagcggcacagggaggccagcaccacggcaag
ctggtgcggctcgtgctgctgaagctggtggacgaggacctgctcttccacggcgaggcc
tcggagcagctgcgcacgcgcggcgccttcgagacccgcttcgtgtcgcaggtggagagc
gactcgggcgaccgcaagcagatctacaacatcctgagcacactggggctgaggccctcg
gccaccgactgcgacatcgtgcgccgagcctgcgagagtgtgtccacgcgcgccgcgcac
atgtgcggcgcggggctggcgggcgtcatcaaccgcatgcgcgagagccgcagcgaggac
gtgatgcgcatcaccgtgggcgtggacggctcggtgtacaagttgcaccccagcttcaag
gagcggttccatgccatcgtgcgcaggctgacccccagctgcgagatcaccttcatccag
tcggaggagggcagtggccggggcgcagctcttgtctccgccgtcgcctgtaagaaggcc
tgcatgttgggccagtga

DBGET integrated database retrieval system