KEGG   Pteropus alecto (black flying fox): 102884388
Entry
102884388         CDS       T02993                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04064  NF-kappa B signaling pathway
pale04120  Ubiquitin mediated proteolysis
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04217  Necroptosis
pale04390  Hippo signaling pathway
pale04510  Focal adhesion
pale04621  NOD-like receptor signaling pathway
pale04668  TNF signaling pathway
pale05132  Salmonella infection
pale05145  Toxoplasmosis
pale05168  Herpes simplex virus 1 infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102884388
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102884388
   04064 NF-kappa B signaling pathway
    102884388
   04668 TNF signaling pathway
    102884388
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102884388
   04215 Apoptosis - multiple species
    102884388
   04217 Necroptosis
    102884388
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102884388
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102884388
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102884388
   05202 Transcriptional misregulation in cancer
    102884388
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102884388
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102884388
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102884388
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102884388
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102884388
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pale01002]
    102884388
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102884388
Peptidases and inhibitors [BR:pale01002]
 Peptidase inhibitors
  Family I32: IAP family
   102884388
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102884388
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_5 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 102884388
NCBI-ProteinID: XP_006907571
LinkDB
Position
Unknown
AA seq 610 aa
MNIVENSVFLSNLMKSANMFELKYDLSCELYRMSTYSFFPTGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKQGDNPIEKHKKLYPSCSFVQKLNSGSISGATSQFTFPSSVTNS
TQSFPSSLENSEYFSGSFSSFPSNPVNFGSNPVNSRPNQDFAALRRSSYGYAMNTLNARL
LTFQKWPLTFLSPRDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHLRHFPNCP
FLENQFQDTSYTVSNLSMQTQAARMKTFCNWPSSVAVHPKQLASAGFYYMGHNDDVKCFC
CDGGLRCWEYGDDPWVEHAKWFPRCEYLIRIKGQEFISQIQASYPHLLEQLLSTSDNPED
GNAESPIVHYGPGENHSEDAVMMNTPVVKAALDMGFSRRLVKQTVQSKILTTGENYKTVS
DLVLDLLNAEDEIREEEKERATEEQESDDLSYIRKNRMALFQHLTCVLPILDSLLTARVI
NKQEHDIIKQKTQTSLQARELIDIIIVKGNDAATAFRNSLQEIDLTLYKHLFVQRDIKYI
PTENVSDLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRGT
IKGTVRTFLS
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgaatatagtagaaaatagcgtattcttgtcaaatttgatgaaaagtgccaacatgttt
gaattgaaatatgacctttcatgtgaactgtatcgaatgtctacgtattcatttttcccc
actggtgttcctgtctcagagaggagtcttgctcgtgctggtttttattacactggtgtg
aatgacaaggtcaaatgcttctgttgtggcctgatgctggataactggaaacaaggagac
aatcctattgaaaagcataaaaagttgtatcctagctgcagttttgttcagaaactaaat
tcaggtagcatttcgggagccacttctcagtttacttttccttcttcagtaacaaattcc
acacagtcatttccgtcaagtttggaaaacagtgaatatttcagtggctctttttcaagc
tttccgtcaaatccagtaaactttggatcaaatcctgtaaactcgagaccgaatcaagat
tttgctgccttgaggagaagttcctacggttatgcaatgaatactctaaatgccagatta
cttactttccagaagtggccattgacctttctgtcgccaagagacctggcaaaagcaggt
ttttactacataggacccggagacagagtggcttgctttgcctgtggtggaaaattgagc
aattgggaaccaaaggatgatgctatgtcagaacacctgagacatttcccaaattgtcca
tttttagaaaatcagtttcaagacacttcatacactgtttctaatctgagcatgcagacc
caggcagctcgtatgaaaacattctgtaattggccctctagtgttgcagttcatcctaag
cagcttgcaagtgcaggcttttattatatgggtcacaatgatgatgtaaaatgcttttgc
tgtgatggtggactgaggtgttgggaatacggagatgacccatgggtggaacacgccaag
tggtttccaaggtgtgaatatttgatacgaattaaaggacaagagttcatcagtcaaatt
caagccagttaccctcatctacttgaacagctgttatctacttcagacaatccagaagat
ggaaatgcagagtcaccaattgttcattatggacctggagaaaaccattcagaagatgca
gtcatgatgaatacacctgtggttaaagctgctttggatatgggctttagcagaaggctg
gtaaaacagacagttcagagtaaaatcctaacaaccggagagaattacaaaaccgtcagt
gatctcgtattagatttacttaatgcagaagatgaaataagagaagaggagaaagaaagg
gcaactgaggaacaagaatcagatgatctatcatatattcgaaagaatagaatggcactt
tttcaacatttgacttgtgtgcttccaattctggatagtctactaactgccagagtaatc
aacaaacaagaacatgatattattaaacagaaaacacagacatctttgcaagcaagagaa
ttgattgatatcattatagtaaaaggaaatgatgcagccactgcattcagaaattctcta
caagaaattgacctcacattatacaagcatttatttgtgcaacgggacataaagtatatt
cccacagaaaatgtttcagatttaccagtggaagaacaattgaggagactacaagaagaa
agaacatgtaaagtgtgtatggacaaagaagtgtccatagtgtttattccttgtggtcat
ctagtagtatgcaaagattgtgccccttctctaagaaaatgtcctatttgtagaggtaca
atcaagggtacagttcgtacatttctttcatga

KEGG   Pteropus alecto (black flying fox): 102884651
Entry
102884651         CDS       T02993                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat-containing protein 2 isoform X1
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04064  NF-kappa B signaling pathway
pale04120  Ubiquitin mediated proteolysis
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04217  Necroptosis
pale04390  Hippo signaling pathway
pale04510  Focal adhesion
pale04621  NOD-like receptor signaling pathway
pale04668  TNF signaling pathway
pale05132  Salmonella infection
pale05145  Toxoplasmosis
pale05168  Herpes simplex virus 1 infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102884651 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102884651 (BIRC2)
   04064 NF-kappa B signaling pathway
    102884651 (BIRC2)
   04668 TNF signaling pathway
    102884651 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102884651 (BIRC2)
   04215 Apoptosis - multiple species
    102884651 (BIRC2)
   04217 Necroptosis
    102884651 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102884651 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102884651 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102884651 (BIRC2)
   05202 Transcriptional misregulation in cancer
    102884651 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102884651 (BIRC2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102884651 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102884651 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102884651 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102884651 (BIRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pale01002]
    102884651 (BIRC2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102884651 (BIRC2)
Peptidases and inhibitors [BR:pale01002]
 Peptidase inhibitors
  Family I32: IAP family
   102884651 (BIRC2)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102884651 (BIRC2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 102884651
NCBI-ProteinID: XP_006907572
LinkDB
Position
Unknown
AA seq 598 aa
MEDSTILSNWTIGNKHKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKV
KCFCCGLMLDNWKQGDNPIEKHKKLYPSCSFIQNLVSLTNLESTFKNISPMRNSLTHSLS
PTLEHGGSSSGSHSSLSPNPLNSRAVEDFSPLRTNPYSYAMSTEEARFLTYHMWPLTFLS
PSELARAGFYYIGPGDRVACFACGGTLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFS
TSNLSMQTHAARLRTFMRWPSSVPVQPELLASAGFYYVGHNDDVKCFCCDGGLRCWESGD
DPWVEHAKWFPRCEFLIRMKGQEFVDEIQARYPYLLEQLLSTSDTPRDENADPPIVHFGP
GESSSEDAVMMNTPVVKAALEMGFSRSLVKQTVQSKILTTGENYKTVNDIVSALLNAEDE
KRQEEKERQTEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANIINKQEHDIIKQKT
QIPLQARELIDTVLVKGNAAANIFKNCLKEIDSALYKNLFVEKNMKYIPTEDVSGLSLEE
QLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS
NT seq 1797 nt   +upstreamnt  +downstreamnt
atggaagatagcaccatcttgtcaaattggacaatcggcaacaaacacaaaatgaaatat
gacttttcatgtgaactctacagaatgtctacgtattcaactttccctgctggtgttcct
gtctcagaaagaagtcttgctcgtgctggtttttattacactggtgtgaatgacaaggtc
aaatgcttctgttgtggcctgatgctggataattggaaacaaggagacaatcctattgaa
aagcataaaaagttgtatcctagctgtagctttattcagaatctggtttctcttactaat
ttggaatccacctttaagaatatttctccgatgagaaacagtttgacacattcattatct
cccactttggaacatggtggctcatccagtggttctcattccagcctttcaccaaaccct
cttaattctagagcagttgaagacttctccccattgaggactaacccctacagttatgca
atgagtactgaagaagccagatttctcacttaccacatgtggccattaacctttttgtca
ccatcagaattggcaagagctggtttttattacataggacctggagatagggtagcctgc
tttgcctgtggtgggacactaagtaactgggaaccaaaggatgatgctatgtcagaacac
cggagacatttccccaactgtccgtttttggaaaattctctagaaacgctgaggtttagc
acttcaaatttgagcatgcagacacacgcagctcgactgagaacatttatgcgctggcca
tctagtgttccagttcaacctgagctgcttgcaagtgctggtttctattatgtgggtcac
aatgatgatgtcaaatgcttttgttgtgatggtggcttaaggtgttgggaatctggagat
gacccatgggtagaacatgccaagtggtttccaaggtgtgagttcttgatacgcatgaaa
ggacaggagtttgttgatgagattcaagcaagatatccttatcttcttgaacagctgttg
tcaacttcggacactcctagagatgaaaatgctgatccaccaattgttcattttggacct
ggagaaagttcttcagaagatgcagtcatgatgaatacacctgtggttaaagctgctttg
gaaatgggctttagcagaagcctggtaaaacagacagttcagagtaaaatcctaacaact
ggagagaattacaaaacagttaatgatattgtgtcagcacttcttaatgctgaagatgaa
aaaagacaagaggagaaggagagacaaactgaagaaatggcatcagatgatttgtcatta
attcggaagaatagaatggctctctttcagcaattgacatgtgtgcttcctattctggat
aatcttttaaaggccaatataattaataaacaggaacatgatataattaaacagaaaaca
cagatacctttacaagcaagagaacttattgatactgttttagttaaaggaaatgctgca
gccaacatcttcaaaaactgtctaaaagaaatcgactctgcattatataagaacttattt
gtggaaaagaatatgaagtatattccaacagaagatgtttcaggtttgtcactagaagaa
caattgaggagattgcaagaagaaagaacttgtaaagtgtgtatggacaaagaagtttct
attgtattcattccttgtggtcatctggtagtatgccaggaatgtgccccttctctaaga
aaatgccctatttgcaggggtataattaagggtactgtccgtacatttctctcataa

KEGG   Pteropus alecto (black flying fox): 102885349
Entry
102885349         CDS       T02993                                 

Gene name
XIAP
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04064  NF-kappa B signaling pathway
pale04120  Ubiquitin mediated proteolysis
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04217  Necroptosis
pale04510  Focal adhesion
pale04621  NOD-like receptor signaling pathway
pale05145  Toxoplasmosis
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102885349 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102885349 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102885349 (XIAP)
   04215 Apoptosis - multiple species
    102885349 (XIAP)
   04217 Necroptosis
    102885349 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102885349 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102885349 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885349 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102885349 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102885349 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102885349 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102885349 (XIAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pale01002]
    102885349 (XIAP)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102885349 (XIAP)
   03029 Mitochondrial biogenesis [BR:pale03029]
    102885349 (XIAP)
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102885349 (XIAP)
Peptidases and inhibitors [BR:pale01002]
 Peptidase inhibitors
  Family I32: IAP family
   102885349 (XIAP)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102885349 (XIAP)
Mitochondrial biogenesis [BR:pale03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    102885349 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2
Other DBs
NCBI-GeneID: 102885349
NCBI-ProteinID: XP_006916224
LinkDB
Position
Unknown
AA seq 495 aa
MTFNSCEGSKTCVPADIDKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFENNTTQPTNSGVQNGQCKAENC
LGNRNHFILDRPSETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKTFQNWPEYAHLT
PSELANAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNIRSE
SDVSSDRNFSNSTNPPRNPAMADYEARIITFGMWMYSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEEKGQEYINSIHLTHSLESMGRTAEKTPSL
TKIIDDTIFQNPMAHEAIRMGFSFRDIKKIMEEKIQTSGSNYKSLEVLVADLVSAQKDNM
QDESSQTSLQKEISTEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCSEAVNKCP
MCYTVITFKQKIFMS
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgacttttaacagttgtgaaggatctaaaacttgtgtacctgcagacatcgataaggat
gaagaatttgtagaagagtttaatagattaaaaacttttgctaattttccaagtagtagt
cctgtttcagcatcaacgctagcacgagctggttttctatatactggtgaaggagacacc
gtgcggtgctttagttgtcacgcagcagtagatagatggcaatatggagactcagcagtt
ggaagacacaggaaagtatccccaaattgcagatttatcaatggcttttattttgaaaat
aatactacgcaacctacaaattctggtgtccaaaatggtcagtgcaaagctgaaaactgt
ctgggaaacagaaatcattttattttagacagaccatctgagactcatgcagactatctt
ttgagaactggacaggttgtagatatatcagacaccatatacccaaggaaccctgccatg
tgtagtgaagaagctagattaaagacatttcagaactggccagaatatgcccacttaacc
ccaagcgagttagctaatgctgggctctactacacaggtattgatgaccaagtgcagtgc
ttttgttgtggtgggaaattgaaaaattgggaaccttgtgatcgtgcatggtcagaacac
aggcgacactttcctaactgcttctttgttttgggccggaatgttaatattcgaagtgaa
tctgatgtgagttctgataggaatttttcaaattcaacaaatcctccaagaaatccagcc
atggcagattatgaagcacggatcataacttttgggatgtggatgtactcagttaacaag
gagcagcttgcaagagctggattttatgccttaggtgaaggtgataaagtaaagtgcttt
cactgtggaggagggctaactgattggaagcctagtgaagacccttgggaacaacatgct
aagtggtatccagggtgtaaatatctgttagaagagaaggggcaagaatatataaacagc
attcatttaacccattcacttgagtctatgggaagaactgctgaaaaaacaccatcacta
actaaaataattgatgatactatcttccaaaatcctatggcacatgaagctatacgaatg
gggttcagtttcagagacattaagaaaataatggaggaaaaaattcagacatctgggagc
aactataaatcactcgaggttctggttgcagatttagtgagtgctcagaaagacaatatg
caagatgaatcaagtcagacttcgctgcagaaagagattagtactgaagagcagctaagg
ctcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctgtagtgttt
attccttgtggacatctggtcacttgtaaacagtgttctgaagcagttaataaatgtccc
atgtgctacacagtcattactttcaagcaaaaaatttttatgtcttag

KEGG   Pteropus alecto (black flying fox): 102888083
Entry
102888083         CDS       T02993                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04390  Hippo signaling pathway
pale05161  Hepatitis B
pale05200  Pathways in cancer
pale05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102888083 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102888083 (BIRC5)
   04215 Apoptosis - multiple species
    102888083 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102888083 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102888083 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102888083 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102888083 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pale01002]
    102888083 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pale03036]
    102888083 (BIRC5)
Peptidases and inhibitors [BR:pale01002]
 Peptidase inhibitors
  Family I32: IAP family
   102888083 (BIRC5)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     102888083 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102888083 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 102888083
NCBI-ProteinID: XP_006912238
UniProt: L5KL79
LinkDB
Position
Unknown
AA seq 142 aa
MGAPSLPAAWQLYLKDHRVSTFKNWPFLEGCACTPERMAAAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDKERTKNKIAKETNSK
QKEFEETAKKVRYAIEQLATTE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggcgccccgtcgttgcccgcggcctggcagctttacctcaaggaccaccgcgtctct
acgttcaagaactggcccttcctggagggctgcgcctgcaccccggaacggatggccgcg
gccggcttcatccactgccccaccgagaatgagcccgacttggcccagtgcttcttctgt
ttcaaggagctggaaggctgggagccagatgacgaccccatagaggaacataaaaagcat
tcgtctggttgtgctttcctttctgtcaagaagcagtttgaagaattaaccctcggtgaa
tttttgaaactggacaaagaaagaaccaagaacaaaatcgcaaaggagaccaacagcaag
cagaaggaatttgaagaaacagcaaagaaagtacgctacgccatcgagcagctggccacc
acggagtga

DBGET integrated database retrieval system