KEGG   Pteropus alecto (black flying fox): 102884423Help
Entry
102884423         CDS       T02993                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale05164  Influenza A
pale05202  Transcriptional misregulation in cancer
pale05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    102884423 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    102884423 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    102884423 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pale01002]
    102884423 (TMPRSS2)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102884423 (TMPRSS2)
Peptidases [BR:pale01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102884423 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Trypsin_2 Ldl_recept_a VEGFR-2_TMD
Motif
Other DBs
NCBI-GeneID: 102884423
NCBI-ProteinID: XP_024905986
LinkDB All DBs
Position
Unknown
AA seq 534 aa AA seqDB search
MALSSGSPPPSVGPYYENGGYQPDSLYPPRPAVAPTAFSVYPAPYYPPAVPQYTPRVPTS
ASTPASLVQPKSPSGTLCTSRTRKALCIAFALGTVLVGAVVAAVLLWKFMDNKCSVSGME
CGSSGTCVTASQWCDGVLNCPSGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWSES
YGRAACQDMGYRNSFYTSQGTADDSGATSFMKINRSADDTDLYKKLYHSDVCSSKTVVSL
RCIECGVTAKMGLSRQSRIVGGTNAASGDWPWQVSLHVQGTHVCGGSIITPDWIVTAAHC
VEEPLNNPRYWTAFAGILRQSFMFYGSGYRVEKVISHPNYDSNTKNNDIALMKLQAPLTF
TDKVKPVCLPNPGLMLEPTQPCWISGWGATYEKGKTSDVLNAAMVPLIEPWRCNNRYVYN
NLVTPAMICAGYLQGAVDSCQGDSGGPLVTLKSSIWWLIGDTSWGSGCAKAYRPGVYGNV
TVFTDWIYRQMRVTFLPPPDWVLSLAVPKPDVPRRGPAAARWPTAVGEVQAPPP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggctttaagctcgggatcaccaccaccgagcgttggaccttactacgaaaatggtgga
taccagcccgacagtctgtatcccccgcgacccgctgtggcccccactgccttctcggtg
tatccggctccatactacccgcccgcggtaccccagtacaccccgagggttccaacgagc
gcttcgacacccgccagcctcgtgcagcccaaatccccgtcagggacactgtgtacctca
aggactaggaaagcgctgtgcatcgcctttgccctggggaccgtcctcgtgggagccgtg
gtggctgctgtcttgctctggaagttcatggacaacaagtgctccgtgtccgggatggag
tgtggctcctcagggacctgcgtcactgcctctcagtggtgcgacggggtcctgaactgc
cccagcggggaggacgagaaccggtgtgttcgcctctatggaccaaacttcatccttcag
gtgtactcgtcccagaggaagtcctggcaccccgtgtgccaggacgattggagcgagagc
tacgggagggcggcgtgccaggacatgggctacaggaacagtttttacactagtcaagga
acagcagatgacagcggggccaccagcttcatgaagatcaacagaagtgcagacgacacc
gacctctataaaaaactctaccacagtgatgtctgttcttcaaagacagtggtttctctg
cgctgtatagaatgcggggtcaccgccaagatgggcctgagccgccagagtcggatcgtg
ggcgggacgaacgctgcctcgggggactggccctggcaggtcagcctacatgtccagggc
acccacgtctgcggagggtccatcatcacccccgactggatagtgacagccgcccactgc
gtggaggaacctctgaacaacccgcggtactggacggccttcgccggcattctgcggcaa
tccttcatgttctacggcagtggctaccgggtagaaaaagtgatctctcacccaaattat
gactccaacaccaagaacaacgacatcgcgctcatgaagctgcaggcgcccctgactttt
accgacaaagtgaaacctgtgtgtctgcccaacccgggcctgatgctggagcccacgcag
ccctgctggatctctgggtggggggccacctacgagaaagggaaaacctcggacgtgctg
aacgccgccatggtgcccctgatcgagccctggaggtgtaacaacagatacgtctacaac
aacctggtcacaccggccatgatctgcgcagggtacctgcagggggctgtcgattcctgc
cagggtgacagtggtggtcctctggtcactttgaagagcagcatctggtggctgattggg
gacacgagctgggggtccggctgtgccaaggcctacaggccaggggtgtacggaaacgtg
acggtattcacggactggatctaccgacaaatgagggtaactttccttccgcctcccgac
tgggttctctccctcgctgtgccaaagcccgatgtcccaaggcgcggtccggctgcagca
aggtggccgacagctgtcggcgaggtgcaggcaccgcccccttaa

DBGET integrated database retrieval system